Electrophorus electricus (electric eel): 113584910 Help Entry 113584910         CDS       T05787                                  Symbol hmgb1 Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism eee  Electrophorus electricus (electric eel) Pathway eee03410   Base excision repair eee04140   Autophagy - animal eee04217   Necroptosis Brite KEGG Orthology (KO) [BR:eee00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     113584910 (hmgb1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113584910 (hmgb1)   09143 Cell growth and death    04217 Necroptosis     113584910 (hmgb1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:eee03036]     113584910 (hmgb1)    03400 DNA repair and recombination proteins [BR:eee03400]     113584910 (hmgb1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113584910 (hmgb1) Chromosome and associated proteins [BR:eee03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     113584910 (hmgb1) DNA repair and recombination proteins [BR:eee03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      113584910 (hmgb1)    MMR (mismatch excision repair)     Other MMR factors      113584910 (hmgb1) Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    113584910 (hmgb1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 HMG_box_5 NOA36 Ets Motif Other DBs NCBI-GeneID:  113584910 NCBI-ProteinID:  XP_026877928 LinkDB All DBs Position Unknown AA seq 204 aa AA seqDB search MGKDPTKPRGKMSSYAYFVQTCREEHKKKHPDTSVNFSEFSKKCSERWKTMSAKEKGKFE EMARLDKARYEREMKNYVPPRGEKKKRFKDPNAPKRPPSAFFIFCAEYRPKVKEETPGLS IGDVAKKLGEMWNKTSAEEKQPYEKKAAKLKEKYEKDIAAYRKGKVVGGAAKAPTKPDKT NDEEDDDDDDEDDDDEEDDDDDDE NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atggggaaagacccaacaaagccaagaggaaaaatgtcctcttatgcctattttgttcag acctgtagagaggaacacaagaagaaacatcctgacacatctgtcaacttttcagagttc tctaaaaagtgctctgagcgatggaagactatgtcagccaaggaaaagggcaagtttgaa gagatggccagacttgacaaggcacgttatgagcgggagatgaagaactatgttcctccc agaggcgaaaagaagaagaggtttaaggaccccaatgcccccaagagaccaccgtcggcc tttttcattttctgcgcggaatatcggcccaaggtgaaggaggagactccaggtctgtct atcggagatgtggccaagaagcttggagagatgtggaacaagacgtctgctgaagagaag cagccttatgagaagaaagcagccaaactgaaggagaaatatgagaaggacattgctgca tatcgaaagggaaaagttgtggggggtgctgcaaaagcccccaccaagccagacaaaacc aacgacgaagaagacgatgatgacgacgacgaggatgatgacgatgaagaggacgatgat gatgacgatgagtaa

DBGET integrated database retrieval system