Electrophorus electricus (electric eel): 113589948 Help Entry 113589948         CDS       T05787                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism eee  Electrophorus electricus (electric eel) Pathway eee04137   Mitophagy - animal eee04140   Autophagy - animal eee04144   Endocytosis eee04145   Phagosome eee04148   Efferocytosis eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     113589948    04145 Phagosome     113589948    04140 Autophagy - animal     113589948    04137 Mitophagy - animal     113589948    04148 Efferocytosis     113589948  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113589948  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:eee04131]     113589948   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113589948    04031 GTP-binding proteins [BR:eee04031]     113589948 Membrane trafficking [BR:eee04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     113589948 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    113589948   Exosomal proteins of other body fluids (saliva and urine)    113589948   Exosomal proteins of colorectal cancer cells    113589948   Exosomal proteins of bladder cancer cells    113589948 GTP-binding proteins [BR:eee04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     113589948 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  113589948 NCBI-ProteinID:  XP_026885630 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcgaggaagaaagtcctactcaaagtgatcatcctgggagactctggcgtgggg aagacctctctgatgaaccagtacgtaaacaagaagtttagcaaccaatacaaagccaca ataggagctgatttcctgacaaaggaggtgatggtggatgaccgactcgtcacgatgcag atctgggacacagcgggtcaggagcgctttcagtcgctgggcgtggctttctaccgcggt gccgactgctgtgtgctcgtcttcgacgtcacggcgcccaacaccttcaagaccctggac agctggcgggacgagttcctgatccaggccagcccacgcgaccctgagaactttcccttt gtagtgctcggcaacaaaatcgacttggagaacaggcaggtaaccaccaagcgggcacaa gcctggtgtcagagcaagaacaacatcccctacttcgagaccagcgcaaaagaggccatt aacgtagaacaggctttccaaaccattgcccgcaacgcactgaaacaggagactgaggtg gagttatacaacgagttcccagaacccatcaagctagataggaatgagagagccaagcca tcagcagaaacctgcagctgctga

DBGET integrated database retrieval system