Electrophorus electricus (electric eel): 113591428 Help Entry 113591428         CDS       T05787                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism eee  Electrophorus electricus (electric eel) Pathway eee04010   MAPK signaling pathway eee04068   FoxO signaling pathway eee04081   Hormone signaling eee04114   Oocyte meiosis eee04140   Autophagy - animal eee04150   mTOR signaling pathway eee04810   Regulation of actin cytoskeleton eee04910   Insulin signaling pathway eee04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:eee00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     113591428 (ins)    04068 FoxO signaling pathway     113591428 (ins)    04150 mTOR signaling pathway     113591428 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     113591428 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     113591428 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     113591428 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     113591428 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     113591428 (ins)    04914 Progesterone-mediated oocyte maturation     113591428 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:eee04052]     113591428 (ins) Cytokines and neuropeptides [BR:eee04052]  Neuropeptides   Unclassified    113591428 (ins) SSDB OrthologParalogGFIT Motif Pfam:  Insulin PEX6_vert_N Motif Other DBs NCBI-GeneID:  113591428 NCBI-ProteinID:  XP_026887713 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MAAWIQAGTLLLLLALSTAGANAAAPQHLCGSHLVDALYLVCGPSGFFYNPKREVDPLLG FLSSKAGQEGEMAEYPYREHAELMVKRGIVEQCCHKPCSIFDLQNYCN NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcgtggatccaggctggtactcttctgctcctgttggctctgtccactgcagga gccaacgctgccgctccccaacacctgtgcggatctcacttggtcgacgccctctacctt gtctgtggcccatcaggcttcttttacaaccccaagagagaggtggacccactgctgggt ttcctttcctccaaggcgggtcaggagggtgagatggccgagtacccgtacagagagcac gcggagctgatggtaaagaggggcatcgtggaacagtgctgccacaaaccctgcagcatc tttgacctgcagaactactgcaactag

DBGET integrated database retrieval system