Electrophorus electricus (electric eel): 113591707 Help Entry 113591707         CDS       T05787                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism eee  Electrophorus electricus (electric eel) Pathway eee04382   Cornified envelope formation eee05132   Salmonella infection Brite KEGG Orthology (KO) [BR:eee00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     113591707  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     113591707  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:eee04147]     113591707 Exosome [BR:eee04147]  Exosomal proteins   Exosomal proteins of microglial cells    113591707 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  113591707 NCBI-ProteinID:  XP_026888121 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MPTELETAIETLITVFHRYAKKDSDDNALNRKELRMLMETELKSFLKCQKDPATVDKIMR DLDANSDGVVNFQEFVSLVVGLSVACEQIYQLQKTGKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgccgactgagctggagacagcgattgaaactttaattacagtgttccaccgttacgcg aagaaagatagtgacgataacgcgctcaaccgcaaagagctgcgcatgctcatggagaca gaacttaaaagcttcctcaagtgtcagaaagacccagccaccgtggacaagataatgaga gatctggacgctaacagtgatggagtagtaaactttcaagagtttgtgtctctggtggtc ggcctgtccgtggcctgcgaacagatataccaacttcagaagaccggaaaaaagtag

DBGET integrated database retrieval system