Eikenella exigua: EZJ17_02370 Help Entry EZJ17_02370       CDS       T06211                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eex  Eikenella exigua Pathway eex01100   Metabolic pathways eex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EZJ17_02370 (acpP)    00074 Mycolic acid biosynthesis     EZJ17_02370 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EZJ17_02370 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  QED91612 UniProt:  A0AAX1F694 LinkDB All DBs Position 446474..446710 Genome browser AA seq 78 aa AA seqDB search MENIEQRVKKIVAEQLGKSESEVKNESSFSEDLGADSLDVVELVMALEEAFGCDIPDEEA EKITTVQQAIDFVTSRSN NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaaatatcgaacaacgtgtgaagaaaatcgttgccgaacaattgggtaagagcgaa agcgaagtgaaaaacgaatcttctttcagcgaagatttgggcgctgactctctggacgtg gttgagctggtaatggctttggaagaagctttcggctgtgacatccccgatgaagaagct gaaaaaatcactaccgttcaacaagccattgacttcgttacttcccgctccaactaa

DBGET integrated database retrieval system