Eikenella exigua: EZJ17_07695 Help Entry EZJ17_07695       CDS       T06211                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eex  Eikenella exigua Pathway eex01100   Metabolic pathways eex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EZJ17_07695    00074 Mycolic acid biosynthesis     EZJ17_07695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EZJ17_07695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4456 Motif Other DBs NCBI-ProteinID:  QED92500 UniProt:  A0AAX1F8W8 LinkDB All DBs Position complement(1486681..1486962) Genome browser AA seq 93 aa AA seqDB search MPDLSSPALEQALKSLIVRETEKQDDVDMAAFADDSPLFGPESPVGLDSLDALQITVALQ ARYGVRLNGDRMVRKHMMNVRDLAAFIREQHGA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgcccgatttaagctcccccgcgctggagcaggccttgaaaagcctgattgtgcgcgaa accgaaaaacaagacgatgtggacatggccgcctttgccgacgactccccgctattcggc ccggaaagcccggtcggcctcgattcgctcgacgcgctgcaaatcaccgtcgccctgcaa gcccgttacggcgtgcgcctcaacggcgaccgcatggtgcgcaaacacatgatgaacgtg cgcgatttggccgcctttatccgcgaacagcacggcgcataa

DBGET integrated database retrieval system