Eikenella exigua: EZJ17_09310 Help Entry EZJ17_09310       CDS       T06211                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism eex  Eikenella exigua Pathway eex01100   Metabolic pathways eex01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eex00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EZJ17_09310    00074 Mycolic acid biosynthesis     EZJ17_09310   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EZJ17_09310 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QED92776 UniProt:  A0AAX1F9R6 LinkDB All DBs Position 1835143..1835403 Genome browser AA seq 86 aa AA seqDB search MTDLKQEIKQLIIDSLGLEDLTPADIGDEEALFGNSGLGLDSVDALELGLAVQKHFGFQL DGESQELRDSFANVSTLAAFVQKQRG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgactgacttgaaacaagaaatcaaacaactgattatcgacagcctcggcctggaagac ctcacccccgccgacatcggcgacgaagaagccctgttcggcaacagcggcctcggcctc gattccgtagacgcactcgaactcggcctggccgtgcaaaaacacttcggcttccagctc gacggcgaaagccaggaactgcgtgacagcttcgccaatgtgtccacactggccgctttc gtgcagaaacaacgcggctag

DBGET integrated database retrieval system