KEGG   Empedobacter falsenii: FH779_13205
Entry
FH779_13205       CDS       T06702                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
efal  Empedobacter falsenii
Pathway
efal00770  Pantothenate and CoA biosynthesis
efal01100  Metabolic pathways
efal01240  Biosynthesis of cofactors
Module
efal_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:efal00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    FH779_13205 (coaD)
Enzymes [BR:efal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     FH779_13205 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: QLL58986
UniProt: A0A7H9DWC7
LinkDB
Position
complement(2823254..2823715)
AA seq 153 aa
MDRVAVFPGSFDPITLGHLDIIERAVPLFDKIIVAIGTNSSKNYMFSLEQRIKFIEDSVA
KFENVEVMAYKGLTVDFCDEVNAQFILRGLRNPADFEFEKAIAHTNRAITNHNIETIFLL
TSSGKAYISSSIVRDVMRNGGKYEILVPDVVRI
NT seq 462 nt   +upstreamnt  +downstreamnt
atggatagagtagccgtatttcctgggtcttttgatccaattactttaggacatttagat
attatagagcgtgcagttcctttatttgacaagattattgttgccattggaacaaattca
tcgaagaattatatgttttctttggagcaacgaattaagtttattgaagattctgttgcg
aaattcgaaaatgtagaagtaatggcttacaaaggtctgactgtcgatttttgtgatgag
gtaaatgcacaatttattttacgtggacttcgtaatccagccgatttcgaatttgagaaa
gcgattgcgcacacaaaccgagcaattacaaatcataatatcgaaacaatctttttattg
acatcttctgggaaagcttacatcagttcaagtattgttcgtgatgtcatgcgaaacggg
ggaaaatatgagatattagttccagatgttgtgaggatttaa

DBGET integrated database retrieval system