Effusibacillus dendaii: skT53_14660 Help Entry skT53_14660       CDS       T06872                                  Name (GenBank) hypothetical protein   KO K00558   DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37] Organism eff  Effusibacillus dendaii Pathway eff00270   Cysteine and methionine metabolism eff01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:eff00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     skT53_14660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:eff03000]     skT53_14660    03032 DNA replication proteins [BR:eff03032]     skT53_14660    03036 Chromosome and associated proteins [BR:eff03036]     skT53_14660   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:eff02048]     skT53_14660 Enzymes [BR:eff01000]  2. Transferases   2.1  Transferring one-carbon groups    2.1.1  Methyltransferases     2.1.1.37  DNA (cytosine-5-)-methyltransferase      skT53_14660 Transcription factors [BR:eff03000]  Eukaryotic type   Zinc finger    CXXC CpG-binding proteins     skT53_14660 DNA replication proteins [BR:eff03032]  Eukaryotic type   DNA Replication Termination Factors    DNA methylation enzymes     skT53_14660 Chromosome and associated proteins [BR:eff03036]  Eukaryotic type   Heterochromatin formation proteins    Other heterochromatin formation proteins     skT53_14660 Prokaryotic defense system [BR:eff02048]  Restriction and modification system (R-M system)   Type II R-M system    DNA methyltransferases     skT53_14660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_methylase Cons_hypoth95 TRM5-TYW2_MTfase Motif Other DBs NCBI-ProteinID:  BCJ86481 UniProt:  A0A7I8DEZ5 LinkDB All DBs Position complement(1402451..1402696) Genome browser AA seq 81 aa AA seqDB search MRMLDLFSGIGGISLAASWAGIQTVAFCEIDPFCQKVLAKHWPDVPIFDDVRKINRNALI ERGVMKNVSEPAIDLICGGYP NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ttgaggatgcttgatttgtttagtggaattggaggcatttcgcttgcagctagttgggct ggtattcaaacagtagctttttgcgaaatagatccgttctgtcaaaaggtattagcgaaa cattggcctgatgtaccaatttttgatgatgtgcgcaaaatcaatcgaaatgcgcttatt gaaaggggagtgatgaaaaatgtatccgaaccagcaattgaccttatttgcggcggatac ccatga

DBGET integrated database retrieval system