Effusibacillus dendaii: skT53_19250 Help Entry skT53_19250       CDS       T06872                                  Name (GenBank) hypothetical protein   KO K03075   preprotein translocase subunit SecG Organism eff  Effusibacillus dendaii Pathway eff02024   Quorum sensing eff03060   Protein export eff03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:eff00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     skT53_19250  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     skT53_19250  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     skT53_19250  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:eff02044]     skT53_19250 Secretion system [BR:eff02044]  Sec (secretion) system   Prokaryotic Sec-SRP core components    skT53_19250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecG DUF4389 Motif Other DBs NCBI-ProteinID:  BCJ86940 UniProt:  A0A7I8DEH1 LinkDB All DBs Position complement(1827756..1827992) Genome browser AA seq 78 aa AA seqDB search MLTFAKILLVIFSVLLIITVLLQSGRNAGLSGAITGGAEQMMGRKARGLDAVLAKVTAGL AFGFIVLAVWVAWLVAHS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt ttgcttacattcgcaaaaattttgctggtcatcttcagtgtgctgctgattattaccgtt ctgttgcaatccggccggaatgccggtctgtcaggcgccattacaggtggtgcggaacag atgatgggacgaaaggcgcgcgggttggacgccgtactggcgaaagtgacagctggactg gctttcggttttatcgttttggcggtttgggtggcatggttggtggctcattcataa

DBGET integrated database retrieval system