Eptesicus fuscus (big brown bat): 103283436 Help Entry 103283436         CDS       T09083                                  Symbol NPPC Name (RefSeq) C-type natriuretic peptide   KO K12336   natriuretic peptide C Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04022   cGMP-PKG signaling pathway efus04081   Hormone signaling efus04270   Vascular smooth muscle contraction efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04022 cGMP-PKG signaling pathway     103283436 (NPPC)   09133 Signaling molecules and interaction    04081 Hormone signaling     103283436 (NPPC)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     103283436 (NPPC)  09160 Human Diseases   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103283436 (NPPC)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103283436 (NPPC) Cytokines and neuropeptides [BR:efus04052]  Neuropeptides   Unclassified    103283436 (NPPC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ANP Motif Other DBs NCBI-GeneID:  103283436 NCBI-ProteinID:  XP_008136933 LinkDB All DBs Position 11:63219535..63224463 Genome browser AA seq 116 aa AA seqDB search MHLSQLLACALLLTLLSLWPSEAKPGVPSKGLRTPPGEVSAASQTESGAQKKRDKTLGGG GINLRGDRSRLLRDTKSRWARLLQEKPRRKPQPTTGKKNCFGHKLDRIGAHSGLGC NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgcacctctcccaactgctggcctgcgccctgctgctcaccctactctcgctctggccc tccgaagccaagcccggtgtgccatcgaagggcctgcgaactccgccaggggaggtgtca gccgcgtcccagactgagagcggcgctcagaagaagcgcgacaagactctcggaggcggc ggcatcaacctcaggggcgaccggtcgcgactgctccgggacaccaagtctcgatgggcc cgccttctgcaagagaaaccacgcagaaaaccacagcctactacgggcaagaagaactgc ttcgggcacaagctggaccggatcggcgcccacagtggcctgggatgttag

DBGET integrated database retrieval system