Eptesicus fuscus (big brown bat): 103285154 Help Entry 103285154         CDS       T09083                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01521   EGFR tyrosine kinase inhibitor resistance efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04062   Chemokine signaling pathway efus04068   FoxO signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04150   mTOR signaling pathway efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04211   Longevity regulating pathway efus04213   Longevity regulating pathway - multiple species efus04218   Cellular senescence efus04360   Axon guidance efus04370   VEGF signaling pathway efus04371   Apelin signaling pathway efus04540   Gap junction efus04550   Signaling pathways regulating pluripotency of stem cells efus04625   C-type lectin receptor signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04664   Fc epsilon RI signaling pathway efus04714   Thermogenesis efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04725   Cholinergic synapse efus04726   Serotonergic synapse efus04730   Long-term depression efus04810   Regulation of actin cytoskeleton efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04914   Progesterone-mediated oocyte maturation efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04917   Prolactin signaling pathway efus04919   Thyroid hormone signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04929   GnRH secretion efus04933   AGE-RAGE signaling pathway in diabetic complications efus04935   Growth hormone synthesis, secretion and action efus04960   Aldosterone-regulated sodium reabsorption efus05010   Alzheimer disease efus05022   Pathways of neurodegeneration - multiple diseases efus05034   Alcoholism efus05160   Hepatitis C efus05161   Hepatitis B efus05163   Human cytomegalovirus infection efus05165   Human papillomavirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05211   Renal cell carcinoma efus05212   Pancreatic cancer efus05213   Endometrial cancer efus05214   Glioma efus05215   Prostate cancer efus05216   Thyroid cancer efus05218   Melanoma efus05219   Bladder cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05223   Non-small cell lung cancer efus05224   Breast cancer efus05225   Hepatocellular carcinoma efus05226   Gastric cancer efus05230   Central carbon metabolism in cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103285154 (KRAS)    04012 ErbB signaling pathway     103285154 (KRAS)    04014 Ras signaling pathway     103285154 (KRAS)    04015 Rap1 signaling pathway     103285154 (KRAS)    04370 VEGF signaling pathway     103285154 (KRAS)    04371 Apelin signaling pathway     103285154 (KRAS)    04068 FoxO signaling pathway     103285154 (KRAS)    04072 Phospholipase D signaling pathway     103285154 (KRAS)    04071 Sphingolipid signaling pathway     103285154 (KRAS)    04151 PI3K-Akt signaling pathway     103285154 (KRAS)    04150 mTOR signaling pathway     103285154 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103285154 (KRAS)    04137 Mitophagy - animal     103285154 (KRAS)   09143 Cell growth and death    04210 Apoptosis     103285154 (KRAS)    04218 Cellular senescence     103285154 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103285154 (KRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103285154 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103285154 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103285154 (KRAS)    04650 Natural killer cell mediated cytotoxicity     103285154 (KRAS)    04660 T cell receptor signaling pathway     103285154 (KRAS)    04662 B cell receptor signaling pathway     103285154 (KRAS)    04664 Fc epsilon RI signaling pathway     103285154 (KRAS)    04062 Chemokine signaling pathway     103285154 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103285154 (KRAS)    04929 GnRH secretion     103285154 (KRAS)    04912 GnRH signaling pathway     103285154 (KRAS)    04915 Estrogen signaling pathway     103285154 (KRAS)    04914 Progesterone-mediated oocyte maturation     103285154 (KRAS)    04917 Prolactin signaling pathway     103285154 (KRAS)    04921 Oxytocin signaling pathway     103285154 (KRAS)    04926 Relaxin signaling pathway     103285154 (KRAS)    04935 Growth hormone synthesis, secretion and action     103285154 (KRAS)    04919 Thyroid hormone signaling pathway     103285154 (KRAS)    04916 Melanogenesis     103285154 (KRAS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     103285154 (KRAS)   09156 Nervous system    04725 Cholinergic synapse     103285154 (KRAS)    04726 Serotonergic synapse     103285154 (KRAS)    04720 Long-term potentiation     103285154 (KRAS)    04730 Long-term depression     103285154 (KRAS)    04722 Neurotrophin signaling pathway     103285154 (KRAS)   09158 Development and regeneration    04360 Axon guidance     103285154 (KRAS)   09149 Aging    04211 Longevity regulating pathway     103285154 (KRAS)    04213 Longevity regulating pathway - multiple species     103285154 (KRAS)   09159 Environmental adaptation    04714 Thermogenesis     103285154 (KRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103285154 (KRAS)    05206 MicroRNAs in cancer     103285154 (KRAS)    05205 Proteoglycans in cancer     103285154 (KRAS)    05207 Chemical carcinogenesis - receptor activation     103285154 (KRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103285154 (KRAS)    05203 Viral carcinogenesis     103285154 (KRAS)    05230 Central carbon metabolism in cancer     103285154 (KRAS)    05231 Choline metabolism in cancer     103285154 (KRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103285154 (KRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103285154 (KRAS)    05212 Pancreatic cancer     103285154 (KRAS)    05225 Hepatocellular carcinoma     103285154 (KRAS)    05226 Gastric cancer     103285154 (KRAS)    05214 Glioma     103285154 (KRAS)    05216 Thyroid cancer     103285154 (KRAS)    05221 Acute myeloid leukemia     103285154 (KRAS)    05220 Chronic myeloid leukemia     103285154 (KRAS)    05218 Melanoma     103285154 (KRAS)    05211 Renal cell carcinoma     103285154 (KRAS)    05219 Bladder cancer     103285154 (KRAS)    05215 Prostate cancer     103285154 (KRAS)    05213 Endometrial cancer     103285154 (KRAS)    05224 Breast cancer     103285154 (KRAS)    05223 Non-small cell lung cancer     103285154 (KRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103285154 (KRAS)    05170 Human immunodeficiency virus 1 infection     103285154 (KRAS)    05161 Hepatitis B     103285154 (KRAS)    05160 Hepatitis C     103285154 (KRAS)    05163 Human cytomegalovirus infection     103285154 (KRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103285154 (KRAS)    05165 Human papillomavirus infection     103285154 (KRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103285154 (KRAS)    05022 Pathways of neurodegeneration - multiple diseases     103285154 (KRAS)   09165 Substance dependence    05034 Alcoholism     103285154 (KRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103285154 (KRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103285154 (KRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103285154 (KRAS)    01522 Endocrine resistance     103285154 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103285154 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:efus04031]     103285154 (KRAS) Membrane trafficking [BR:efus04131]  Endocytosis   Macropinocytosis    Ras GTPases     103285154 (KRAS) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103285154 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  103285154 NCBI-ProteinID:  XP_054575190 LinkDB All DBs Position 7:74547162..74589652 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC VKIKKCIIM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg atacagctaattcagaatcactttgtggatgaatatgatcctacaatagaggattcctac aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt gtttttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata aaaagagttaaagactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttacggaattcct tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt gtgaaaattaaaaaatgcattataatgtaa

Eptesicus fuscus (big brown bat): 103291212 Help Entry 103291212         CDS       T09083                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01521   EGFR tyrosine kinase inhibitor resistance efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04062   Chemokine signaling pathway efus04068   FoxO signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04150   mTOR signaling pathway efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04211   Longevity regulating pathway efus04213   Longevity regulating pathway - multiple species efus04218   Cellular senescence efus04360   Axon guidance efus04370   VEGF signaling pathway efus04371   Apelin signaling pathway efus04540   Gap junction efus04550   Signaling pathways regulating pluripotency of stem cells efus04625   C-type lectin receptor signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04664   Fc epsilon RI signaling pathway efus04714   Thermogenesis efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04725   Cholinergic synapse efus04726   Serotonergic synapse efus04730   Long-term depression efus04810   Regulation of actin cytoskeleton efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04917   Prolactin signaling pathway efus04919   Thyroid hormone signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04929   GnRH secretion efus04933   AGE-RAGE signaling pathway in diabetic complications efus04935   Growth hormone synthesis, secretion and action efus05010   Alzheimer disease efus05022   Pathways of neurodegeneration - multiple diseases efus05034   Alcoholism efus05160   Hepatitis C efus05161   Hepatitis B efus05163   Human cytomegalovirus infection efus05165   Human papillomavirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05211   Renal cell carcinoma efus05213   Endometrial cancer efus05214   Glioma efus05215   Prostate cancer efus05216   Thyroid cancer efus05218   Melanoma efus05219   Bladder cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05223   Non-small cell lung cancer efus05224   Breast cancer efus05225   Hepatocellular carcinoma efus05226   Gastric cancer efus05230   Central carbon metabolism in cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103291212 (NRAS)    04012 ErbB signaling pathway     103291212 (NRAS)    04014 Ras signaling pathway     103291212 (NRAS)    04015 Rap1 signaling pathway     103291212 (NRAS)    04370 VEGF signaling pathway     103291212 (NRAS)    04371 Apelin signaling pathway     103291212 (NRAS)    04068 FoxO signaling pathway     103291212 (NRAS)    04072 Phospholipase D signaling pathway     103291212 (NRAS)    04071 Sphingolipid signaling pathway     103291212 (NRAS)    04151 PI3K-Akt signaling pathway     103291212 (NRAS)    04150 mTOR signaling pathway     103291212 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103291212 (NRAS)    04137 Mitophagy - animal     103291212 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103291212 (NRAS)    04218 Cellular senescence     103291212 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103291212 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103291212 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103291212 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103291212 (NRAS)    04650 Natural killer cell mediated cytotoxicity     103291212 (NRAS)    04660 T cell receptor signaling pathway     103291212 (NRAS)    04662 B cell receptor signaling pathway     103291212 (NRAS)    04664 Fc epsilon RI signaling pathway     103291212 (NRAS)    04062 Chemokine signaling pathway     103291212 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103291212 (NRAS)    04929 GnRH secretion     103291212 (NRAS)    04912 GnRH signaling pathway     103291212 (NRAS)    04915 Estrogen signaling pathway     103291212 (NRAS)    04917 Prolactin signaling pathway     103291212 (NRAS)    04921 Oxytocin signaling pathway     103291212 (NRAS)    04926 Relaxin signaling pathway     103291212 (NRAS)    04935 Growth hormone synthesis, secretion and action     103291212 (NRAS)    04919 Thyroid hormone signaling pathway     103291212 (NRAS)    04916 Melanogenesis     103291212 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     103291212 (NRAS)    04726 Serotonergic synapse     103291212 (NRAS)    04720 Long-term potentiation     103291212 (NRAS)    04730 Long-term depression     103291212 (NRAS)    04722 Neurotrophin signaling pathway     103291212 (NRAS)   09158 Development and regeneration    04360 Axon guidance     103291212 (NRAS)   09149 Aging    04211 Longevity regulating pathway     103291212 (NRAS)    04213 Longevity regulating pathway - multiple species     103291212 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     103291212 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103291212 (NRAS)    05206 MicroRNAs in cancer     103291212 (NRAS)    05205 Proteoglycans in cancer     103291212 (NRAS)    05207 Chemical carcinogenesis - receptor activation     103291212 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103291212 (NRAS)    05203 Viral carcinogenesis     103291212 (NRAS)    05230 Central carbon metabolism in cancer     103291212 (NRAS)    05231 Choline metabolism in cancer     103291212 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103291212 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103291212 (NRAS)    05225 Hepatocellular carcinoma     103291212 (NRAS)    05226 Gastric cancer     103291212 (NRAS)    05214 Glioma     103291212 (NRAS)    05216 Thyroid cancer     103291212 (NRAS)    05221 Acute myeloid leukemia     103291212 (NRAS)    05220 Chronic myeloid leukemia     103291212 (NRAS)    05218 Melanoma     103291212 (NRAS)    05211 Renal cell carcinoma     103291212 (NRAS)    05219 Bladder cancer     103291212 (NRAS)    05215 Prostate cancer     103291212 (NRAS)    05213 Endometrial cancer     103291212 (NRAS)    05224 Breast cancer     103291212 (NRAS)    05223 Non-small cell lung cancer     103291212 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103291212 (NRAS)    05170 Human immunodeficiency virus 1 infection     103291212 (NRAS)    05161 Hepatitis B     103291212 (NRAS)    05160 Hepatitis C     103291212 (NRAS)    05163 Human cytomegalovirus infection     103291212 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103291212 (NRAS)    05165 Human papillomavirus infection     103291212 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103291212 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     103291212 (NRAS)   09165 Substance dependence    05034 Alcoholism     103291212 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103291212 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103291212 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103291212 (NRAS)    01522 Endocrine resistance     103291212 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103291212 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103291212 (NRAS)    04031 GTP-binding proteins [BR:efus04031]     103291212 (NRAS) Membrane trafficking [BR:efus04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103291212 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103291212 (NRAS) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103291212 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103291212 (NRAS)   Exosomal proteins of breast cancer cells    103291212 (NRAS)   Exosomal proteins of colorectal cancer cells    103291212 (NRAS) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103291212 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103291212 NCBI-ProteinID:  XP_008145417 LinkDB All DBs Position 22:complement(8945378..8961357) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggtcatagatggtgagacctgtctgttggatatactggacacggctgga caagaggagtacagtgccatgcgggaccaatacatgaggacaggggaaggtttcctctgt gtgttcgccatcaataatagcaagtcatttgcagacattaacctctacagggaacaaatt aagcgagtgaaggactcagatgatgtaccgatggtgctagtaggaaacaagtgtgattta ccaacaaggacagttgacacgaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggctgccttgtgtggtgatgtaa

Eptesicus fuscus (big brown bat): 103297766 Help Entry 103297766         CDS       T09083                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07829   Ras-related protein R-Ras Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04010   MAPK signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04024   cAMP signaling pathway efus04072   Phospholipase D signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04218   Cellular senescence efus04360   Axon guidance efus04371   Apelin signaling pathway efus04625   C-type lectin receptor signaling pathway efus04810   Regulation of actin cytoskeleton efus05132   Salmonella infection efus05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103297766 (RRAS)    04014 Ras signaling pathway     103297766 (RRAS)    04015 Rap1 signaling pathway     103297766 (RRAS)    04371 Apelin signaling pathway     103297766 (RRAS)    04072 Phospholipase D signaling pathway     103297766 (RRAS)    04024 cAMP signaling pathway     103297766 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103297766 (RRAS)    04137 Mitophagy - animal     103297766 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     103297766 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103297766 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103297766 (RRAS)   09158 Development and regeneration    04360 Axon guidance     103297766 (RRAS)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103297766 (RRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103297766 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:efus04031]     103297766 (RRAS) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103297766 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 AAA_22 Motif Other DBs NCBI-GeneID:  103297766 NCBI-ProteinID:  XP_054566465 LinkDB All DBs Position 21:complement(43348064..43352040) Genome browser AA seq 218 aa AA seqDB search MSSGAASATGRGQPRGGGPGPGDPPPSETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDP TIEDSYTKICTVDGVPARLDILDTAGQEEFGAMREHYMRAGHGFLLVFAINDRQSFNEVG KLFTQILRVKDRDDFPIVLVGNKADLEAQRQVPRSEANTFSASHHVAYFEASAKLRLNVD EAFEQLVRAVRKYQEQELPPSPPSAPRKKARGCPCVLL NT seq 657 nt NT seq  +upstreamnt  +downstreamnt atgagcagcggggcggcgtccgcgacggggcgggggcagccccggggtggggggccgggg cccggggaccccccacccagcgagacacacaagctggtggtcgtgggcggcggcggcgtg ggcaagagtgcgctgaccatccagttcatccagtcctacttcgtttccgactacgacccc accatcgaagactcctacaccaagatctgcaccgtggatggcgtcccggcccgactggac atcctggacaccgcgggccaggaggagtttggcgccatgcgggagcattacatgcgcgcc gggcacgggttcctgctggtgtttgccattaacgaccggcagagtttcaacgaggtgggc aagctcttcacgcagatcctgcgggtcaaggaccgagacgacttccccatcgtgttggtc gggaacaaggccgatctggaagcgcagcgccaggtgccccgatctgaagccaacaccttc agcgcctcccaccacgtggcctatttcgaggcctcggccaaactgcgtctcaacgtggac gaggccttcgagcagctggtgcgggctgtccggaagtaccaggagcaggagctcccgccc agcccccccagcgcccccaggaagaaggccaggggctgcccctgcgtcctcctgtag

Eptesicus fuscus (big brown bat): 103302548 Help Entry 103302548         CDS       T09083                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01521   EGFR tyrosine kinase inhibitor resistance efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04062   Chemokine signaling pathway efus04068   FoxO signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04144   Endocytosis efus04150   mTOR signaling pathway efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04211   Longevity regulating pathway efus04213   Longevity regulating pathway - multiple species efus04218   Cellular senescence efus04360   Axon guidance efus04370   VEGF signaling pathway efus04371   Apelin signaling pathway efus04510   Focal adhesion efus04540   Gap junction efus04550   Signaling pathways regulating pluripotency of stem cells efus04625   C-type lectin receptor signaling pathway efus04630   JAK-STAT signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04664   Fc epsilon RI signaling pathway efus04714   Thermogenesis efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04725   Cholinergic synapse efus04726   Serotonergic synapse efus04730   Long-term depression efus04810   Regulation of actin cytoskeleton efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04917   Prolactin signaling pathway efus04919   Thyroid hormone signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04929   GnRH secretion efus04933   AGE-RAGE signaling pathway in diabetic complications efus04935   Growth hormone synthesis, secretion and action efus05010   Alzheimer disease efus05022   Pathways of neurodegeneration - multiple diseases efus05034   Alcoholism efus05132   Salmonella infection efus05160   Hepatitis C efus05161   Hepatitis B efus05163   Human cytomegalovirus infection efus05165   Human papillomavirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05211   Renal cell carcinoma efus05213   Endometrial cancer efus05214   Glioma efus05215   Prostate cancer efus05216   Thyroid cancer efus05218   Melanoma efus05219   Bladder cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05223   Non-small cell lung cancer efus05224   Breast cancer efus05225   Hepatocellular carcinoma efus05226   Gastric cancer efus05230   Central carbon metabolism in cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103302548 (HRAS)    04012 ErbB signaling pathway     103302548 (HRAS)    04014 Ras signaling pathway     103302548 (HRAS)    04015 Rap1 signaling pathway     103302548 (HRAS)    04370 VEGF signaling pathway     103302548 (HRAS)    04371 Apelin signaling pathway     103302548 (HRAS)    04630 JAK-STAT signaling pathway     103302548 (HRAS)    04068 FoxO signaling pathway     103302548 (HRAS)    04072 Phospholipase D signaling pathway     103302548 (HRAS)    04071 Sphingolipid signaling pathway     103302548 (HRAS)    04151 PI3K-Akt signaling pathway     103302548 (HRAS)    04150 mTOR signaling pathway     103302548 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103302548 (HRAS)    04140 Autophagy - animal     103302548 (HRAS)    04137 Mitophagy - animal     103302548 (HRAS)   09143 Cell growth and death    04210 Apoptosis     103302548 (HRAS)    04218 Cellular senescence     103302548 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103302548 (HRAS)    04540 Gap junction     103302548 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103302548 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103302548 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103302548 (HRAS)    04650 Natural killer cell mediated cytotoxicity     103302548 (HRAS)    04660 T cell receptor signaling pathway     103302548 (HRAS)    04662 B cell receptor signaling pathway     103302548 (HRAS)    04664 Fc epsilon RI signaling pathway     103302548 (HRAS)    04062 Chemokine signaling pathway     103302548 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103302548 (HRAS)    04929 GnRH secretion     103302548 (HRAS)    04912 GnRH signaling pathway     103302548 (HRAS)    04915 Estrogen signaling pathway     103302548 (HRAS)    04917 Prolactin signaling pathway     103302548 (HRAS)    04921 Oxytocin signaling pathway     103302548 (HRAS)    04926 Relaxin signaling pathway     103302548 (HRAS)    04935 Growth hormone synthesis, secretion and action     103302548 (HRAS)    04919 Thyroid hormone signaling pathway     103302548 (HRAS)    04916 Melanogenesis     103302548 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     103302548 (HRAS)    04726 Serotonergic synapse     103302548 (HRAS)    04720 Long-term potentiation     103302548 (HRAS)    04730 Long-term depression     103302548 (HRAS)    04722 Neurotrophin signaling pathway     103302548 (HRAS)   09158 Development and regeneration    04360 Axon guidance     103302548 (HRAS)   09149 Aging    04211 Longevity regulating pathway     103302548 (HRAS)    04213 Longevity regulating pathway - multiple species     103302548 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     103302548 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103302548 (HRAS)    05206 MicroRNAs in cancer     103302548 (HRAS)    05205 Proteoglycans in cancer     103302548 (HRAS)    05207 Chemical carcinogenesis - receptor activation     103302548 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103302548 (HRAS)    05203 Viral carcinogenesis     103302548 (HRAS)    05230 Central carbon metabolism in cancer     103302548 (HRAS)    05231 Choline metabolism in cancer     103302548 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103302548 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103302548 (HRAS)    05225 Hepatocellular carcinoma     103302548 (HRAS)    05226 Gastric cancer     103302548 (HRAS)    05214 Glioma     103302548 (HRAS)    05216 Thyroid cancer     103302548 (HRAS)    05221 Acute myeloid leukemia     103302548 (HRAS)    05220 Chronic myeloid leukemia     103302548 (HRAS)    05218 Melanoma     103302548 (HRAS)    05211 Renal cell carcinoma     103302548 (HRAS)    05219 Bladder cancer     103302548 (HRAS)    05215 Prostate cancer     103302548 (HRAS)    05213 Endometrial cancer     103302548 (HRAS)    05224 Breast cancer     103302548 (HRAS)    05223 Non-small cell lung cancer     103302548 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103302548 (HRAS)    05170 Human immunodeficiency virus 1 infection     103302548 (HRAS)    05161 Hepatitis B     103302548 (HRAS)    05160 Hepatitis C     103302548 (HRAS)    05163 Human cytomegalovirus infection     103302548 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103302548 (HRAS)    05165 Human papillomavirus infection     103302548 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     103302548 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103302548 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     103302548 (HRAS)   09165 Substance dependence    05034 Alcoholism     103302548 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103302548 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103302548 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103302548 (HRAS)    01522 Endocrine resistance     103302548 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103302548 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103302548 (HRAS)    04031 GTP-binding proteins [BR:efus04031]     103302548 (HRAS) Membrane trafficking [BR:efus04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103302548 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103302548 (HRAS) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    103302548 (HRAS)   Exosomal proteins of colorectal cancer cells    103302548 (HRAS) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103302548 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G-alpha AAA_22 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103302548 NCBI-ProteinID:  XP_054580891 LinkDB All DBs Position 13:complement(82844107..82847128) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDTHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKVPKPSPPDEGGPG CMSCKCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggtgggggccggcggcgtggggaagagcgccctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcctac cggaagcaagtggtcattgacggggagacgtgtctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggcgagggcttcctctgt gtgttcgccatcaacaacgccaagtccttcgaggacacccaccagtaccgagagcagatc aagcgggtgaaggactcggacgacgtgcccatggtgctggtcgggaacaagtgtgacctg gctgcgcgcaccgtggagtctcggcaggcgcaggacctcgcccgcagctatggcatcccc tacattgagacttccgccaagacgcgccagggcgtggaggacgccttctacacgctggtg cgcgagatccggcagcacaaggtgcccaagccgagcccgccagacgagggcggccccggc tgcatgagctgcaagtgcctgctctcctga

DBGET integrated database retrieval system