Eptesicus fuscus (big brown bat): 103285459 Help Entry 103285459         CDS       T09083                                  Symbol SPX Name (RefSeq) spexin   KO K25694   spexin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     103285459 (SPX)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103285459 (SPX) Cytokines and neuropeptides [BR:efus04052]  Neuropeptides   GPCR binding    103285459 (SPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Spexin Motif Other DBs NCBI-GeneID:  103285459 NCBI-ProteinID:  XP_027999811 LinkDB All DBs Position 7:complement(77502275..77508628) Genome browser AA seq 96 aa AA seqDB search MGNSSSAPQRLLERRNWTPQAMLYLKGAQGRRFIADQSRKKGLSERPPPERRSPNARLLT LPEAAALLLASLQKPQEAGEENLDPTRFLDDSLLHW NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgggaaattccagcagtgcaccacagagactcttggagagaaggaactggactcctcaa gctatgctttacctgaagggcgcacagggacgccgcttcatcgcggaccagagtcggaag aagggactctccgagcggccgccgccggaaagacgaagtccgaatgcccggctactaact ctcccagaggcagcagctctgctattggcttccttgcagaaaccacaagaagctggagaa gaaaaccttgatccaaccagatttctggacgacagtctgctacactggtga

DBGET integrated database retrieval system