Eptesicus fuscus (big brown bat): 103285583 Help Entry 103285583         CDS       T09083                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01521   EGFR tyrosine kinase inhibitor resistance efus01524   Platinum drug resistance efus04014   Ras signaling pathway efus04064   NF-kappa B signaling pathway efus04115   p53 signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04215   Apoptosis - multiple species efus04621   NOD-like receptor signaling pathway efus04630   JAK-STAT signaling pathway efus05012   Parkinson disease efus05014   Amyotrophic lateral sclerosis efus05022   Pathways of neurodegeneration - multiple diseases efus05145   Toxoplasmosis efus05162   Measles efus05166   Human T-cell leukemia virus 1 infection efus05168   Herpes simplex virus 1 infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05202   Transcriptional misregulation in cancer efus05212   Pancreatic cancer efus05220   Chronic myeloid leukemia efus05222   Small cell lung cancer efus05225   Hepatocellular carcinoma efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103285583 (BCL2L1)    04630 JAK-STAT signaling pathway     103285583 (BCL2L1)    04064 NF-kappa B signaling pathway     103285583 (BCL2L1)    04151 PI3K-Akt signaling pathway     103285583 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103285583 (BCL2L1)    04137 Mitophagy - animal     103285583 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     103285583 (BCL2L1)    04215 Apoptosis - multiple species     103285583 (BCL2L1)    04115 p53 signaling pathway     103285583 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103285583 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103285583 (BCL2L1)    05202 Transcriptional misregulation in cancer     103285583 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     103285583 (BCL2L1)    05225 Hepatocellular carcinoma     103285583 (BCL2L1)    05220 Chronic myeloid leukemia     103285583 (BCL2L1)    05222 Small cell lung cancer     103285583 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103285583 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     103285583 (BCL2L1)    05162 Measles     103285583 (BCL2L1)    05168 Herpes simplex virus 1 infection     103285583 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103285583 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     103285583 (BCL2L1)    05014 Amyotrophic lateral sclerosis     103285583 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     103285583 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103285583 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103285583 (BCL2L1)    01524 Platinum drug resistance     103285583 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:efus01009]     103285583 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     103285583 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:efus02000]     103285583 (BCL2L1) Protein phosphatases and associated proteins [BR:efus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103285583 (BCL2L1) Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Centrosome formation proteins    Other centriole associated proteins     103285583 (BCL2L1) Transporters [BR:efus02000]  Other transporters   Pores ion channels [TC:1]    103285583 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  103285583 NCBI-ProteinID:  XP_008139190 LinkDB All DBs Position 12:complement(32285009..32335409) Genome browser AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTEAEVETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggaactggtggttgactttctctcctacaagctgtcccagaaa ggatacagctggagtcagttcagtgatgtggaagagaacagaactgaggccccagaaggg actgaagcagaggtggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccctgcggtgaatggagccactggccacagcagtagcttggatgcccgggaggtg attcccatggcagcggtgaagcaagcgctgagggaggcgggcgatgagtttgaactgagg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgagcaagtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctcgttcggtggggcactgtgcgtggaaagtgtggacaaggagatgcag gtattggtgagtcggattgcaacttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggaggctgggacacttttgtggaactctacgggaacaatgcagca gctgagagccggaagggccaggaacgcttcaatcgctggttcctgacgggcatgactgtg gctggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system