Eptesicus fuscus (big brown bat): 103286184 Help Entry 103286184         CDS       T09083                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04066   HIF-1 signaling pathway efus04120   Ubiquitin mediated proteolysis efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:efus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     103286184 (ELOB)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     103286184 (ELOB)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103286184 (ELOB)   09162 Cancer: specific types    05211 Renal cell carcinoma     103286184 (ELOB)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103286184 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:efus04121]     103286184 (ELOB)    03400 DNA repair and recombination proteins [BR:efus03400]     103286184 (ELOB) Ubiquitin system [BR:efus04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      103286184 (ELOB)    Cul5 complex      103286184 (ELOB) DNA repair and recombination proteins [BR:efus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      103286184 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  103286184 NCBI-ProteinID:  XP_054570613 LinkDB All DBs Position 4:12496857..12504128 Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDSKTLGEC GFTSQTARPQAPATVGLAFRADDAFEALRIEPFSSPPELPDVMKPQDSGSSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgttttccttatgatccggcgccacaagaccaccatcttcacggacgccaaggag tcgagcaccgtgttcgagctgaagcgcatcgtcgagggcattctcaagcggccgcccgac gagcagcggctgtacaaggatgaccaacttctggatgacagcaagacactgggcgagtgt ggcttcaccagtcaaacagctaggccacaggctccagccactgtggggctggccttccgg gcagatgatgcatttgaagctctgcgcattgaacctttctccagccctccagagctgcct gacgtgatgaagccacaggactcaggaagcagtgccaatgaacaagccgtgcagtga

DBGET integrated database retrieval system