Eptesicus fuscus (big brown bat): 103286246 Help Entry 103286246         CDS       T09083                                  Symbol MYL10 Name (RefSeq) myosin regulatory light chain 10   KO K12756   myosin regulatory light chain 10 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04510   Focal adhesion efus04520   Adherens junction efus04670   Leukocyte transendothelial migration efus04810   Regulation of actin cytoskeleton efus04814   Motor proteins efus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:efus00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     103286246 (MYL10)    04520 Adherens junction     103286246 (MYL10)   09142 Cell motility    04814 Motor proteins     103286246 (MYL10)    04810 Regulation of actin cytoskeleton     103286246 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     103286246 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103286246 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:efus04812]     103286246 (MYL10) Cytoskeleton proteins [BR:efus04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      103286246 (MYL10) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C CFAP251_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  103286246 NCBI-ProteinID:  XP_028001079 LinkDB All DBs Position 4:32490774..32498620 Genome browser AA seq 147 aa AA seqDB search MFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINF TVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFIKEKLMTQADRFSEEEIKQMF AAFPPDVCGNLDYRNLCYVITHGEEKD NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgttcgatcagtcccagatccaggagtttaaggaggccttcaccatcatggaccagaac cgggacggcttcattgacaaggaggatctgagggacacctttgctgccctgggccgcatc aatgtgaagaatgaggagctggaggccatggtgaaggaggcccctgggcccatcaacttc acagtctttctgaccatgtttggggagaagctgaagggcacggacccagaggagaccatt ctccatgccttcaaggtgttcgacactgaagggaaaggtttcgtcaaggcggatttcatc aaagagaagctcatgacccaggcagaccggttcagtgaggaggagatcaagcagatgttt gcagctttcccgccagatgtgtgtggcaacctggactacaggaacctatgctatgtcatc acgcatggtgaagagaaagactag

DBGET integrated database retrieval system