Eptesicus fuscus (big brown bat): 103286353 Help Entry 103286353         CDS       T09083                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04621   NOD-like receptor signaling pathway efus05012   Parkinson disease efus05132   Salmonella infection efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103286353 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103286353 (TXN)   09164 Neurodegenerative disease    05012 Parkinson disease     103286353 (TXN)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103286353 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:efus03110]     103286353 (TXN) Chaperones and folding catalysts [BR:efus03110]  Protein folding catalysts   Protein disulfide isomerase    103286353 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 DIM1 A6-like_Thioredoxin-like_C OST3_OST6 AhpC-TSA Thioredoxin_9 Glutaredoxin Thioredoxin_7 Redoxin Motif Other DBs NCBI-GeneID:  103286353 NCBI-ProteinID:  XP_008140033 LinkDB All DBs Position 15:complement(60758841..60771311) Genome browser AA seq 105 aa AA seqDB search MVKQIESKYAFQEALNSAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVLFLEVDVD DCQDVAAECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINEFI NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagcagatcgagagcaagtatgcttttcaggaagccttgaacagtgcgggagat aagctggtagtggtcgacttctccgccacgtggtgtgggccttgcaaaatgatcaagccc ttctttcattccctgtctgagaagtattccaacgtgctgttccttgaagtggatgtggat gactgtcaggatgttgctgcggagtgtgaagtcaaatgcatgccaaccttccagtttttt aaaaagggacaaaaggtgggtgagttttctggagctaataaggaaaaactcgaagccacc atcaatgaattcatttaa

DBGET integrated database retrieval system