Eptesicus fuscus (big brown bat): 103286378 Help Entry 103286378         CDS       T09083                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04010   MAPK signaling pathway efus04020   Calcium signaling pathway efus04022   cGMP-PKG signaling pathway efus04114   Oocyte meiosis efus04218   Cellular senescence efus04310   Wnt signaling pathway efus04360   Axon guidance efus04370   VEGF signaling pathway efus04380   Osteoclast differentiation efus04625   C-type lectin receptor signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04720   Long-term potentiation efus04724   Glutamatergic synapse efus04921   Oxytocin signaling pathway efus04922   Glucagon signaling pathway efus04924   Renin secretion efus05010   Alzheimer disease efus05014   Amyotrophic lateral sclerosis efus05020   Prion disease efus05022   Pathways of neurodegeneration - multiple diseases efus05031   Amphetamine addiction efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103286378 (PPP3R2)    04310 Wnt signaling pathway     103286378 (PPP3R2)    04370 VEGF signaling pathway     103286378 (PPP3R2)    04020 Calcium signaling pathway     103286378 (PPP3R2)    04022 cGMP-PKG signaling pathway     103286378 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103286378 (PPP3R2)    04218 Cellular senescence     103286378 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103286378 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     103286378 (PPP3R2)    04660 T cell receptor signaling pathway     103286378 (PPP3R2)    04658 Th1 and Th2 cell differentiation     103286378 (PPP3R2)    04659 Th17 cell differentiation     103286378 (PPP3R2)    04662 B cell receptor signaling pathway     103286378 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     103286378 (PPP3R2)    04921 Oxytocin signaling pathway     103286378 (PPP3R2)    04924 Renin secretion     103286378 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     103286378 (PPP3R2)    04720 Long-term potentiation     103286378 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     103286378 (PPP3R2)    04380 Osteoclast differentiation     103286378 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103286378 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103286378 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     103286378 (PPP3R2)    05163 Human cytomegalovirus infection     103286378 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     103286378 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     103286378 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     103286378 (PPP3R2)    05014 Amyotrophic lateral sclerosis     103286378 (PPP3R2)    05020 Prion disease     103286378 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     103286378 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     103286378 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103286378 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:efus01009]     103286378 (PPP3R2) Protein phosphatases and associated proteins [BR:efus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103286378 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 Motif Other DBs NCBI-GeneID:  103286378 NCBI-ProteinID:  XP_008140064 LinkDB All DBs Position 15:complement(55228528..55229264) Genome browser AA seq 170 aa AA seqDB search MGNEASYPAEMGSHFDHEEIKRLGKRFKKLDVDSSGALSADELLSLPELWHNPLAQRVFE VFDADGDGEVDFEEFVAGTSQFSLRGDEEQKLRFAFNVYDMDKDGYISNGELFQVLKMMV GNNMQDWELQQVVDKSIIILDTDGDGRLSFEEFRAAVWDLEVHKQLVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atggggaatgaggcgagctaccccgcggagatgggctcccactttgaccacgaggagatt aaaaggctgggcaagcggttcaagaagctggacgtggactcctcgggcgccctgagcgcg gacgagctgctgtcgctgcccgagctgtggcacaacccgctggcgcagcgggtgttcgag gtgttcgacgcggacggcgacggcgaggtggacttcgaggagttcgtcgcggggacctcc cagttcagcctcaggggggacgaggagcagaagctgaggtttgctttcaacgtctacgac atggacaaggacggctacatctccaacggggagctgttccaggtgctgaagatgatggtg ggcaacaacatgcaggactgggagctgcagcaggtggtggacaaaagcatcatcatcctg gacacggacggcgacgggaggctctccttcgaggagttccgagccgccgtgtgggacctg gaggtccacaagcagctggtggtggatgtgtga

DBGET integrated database retrieval system