Eptesicus fuscus (big brown bat): 103286786 Help Entry 103286786         CDS       T09083                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04060   Cytokine-cytokine receptor interaction efus04620   Toll-like receptor signaling pathway efus04622   RIG-I-like receptor signaling pathway efus04625   C-type lectin receptor signaling pathway efus04630   JAK-STAT signaling pathway efus04658   Th1 and Th2 cell differentiation efus04936   Alcoholic liver disease efus04940   Type I diabetes mellitus efus05133   Pertussis efus05134   Legionellosis efus05140   Leishmaniasis efus05142   Chagas disease efus05143   African trypanosomiasis efus05144   Malaria efus05145   Toxoplasmosis efus05146   Amoebiasis efus05152   Tuberculosis efus05162   Measles efus05164   Influenza A efus05168   Herpes simplex virus 1 infection efus05171   Coronavirus disease - COVID-19 efus05200   Pathways in cancer efus05321   Inflammatory bowel disease efus05330   Allograft rejection efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103286786 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103286786 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103286786 (IL12A)    04622 RIG-I-like receptor signaling pathway     103286786 (IL12A)    04625 C-type lectin receptor signaling pathway     103286786 (IL12A)    04658 Th1 and Th2 cell differentiation     103286786 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103286786 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     103286786 (IL12A)    05164 Influenza A     103286786 (IL12A)    05162 Measles     103286786 (IL12A)    05168 Herpes simplex virus 1 infection     103286786 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     103286786 (IL12A)    05134 Legionellosis     103286786 (IL12A)    05152 Tuberculosis     103286786 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     103286786 (IL12A)    05144 Malaria     103286786 (IL12A)    05145 Toxoplasmosis     103286786 (IL12A)    05140 Leishmaniasis     103286786 (IL12A)    05142 Chagas disease     103286786 (IL12A)    05143 African trypanosomiasis     103286786 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     103286786 (IL12A)    05330 Allograft rejection     103286786 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103286786 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103286786 (IL12A)    04936 Alcoholic liver disease     103286786 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103286786 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:efus00536]     103286786 (IL12A) Cytokines and neuropeptides [BR:efus04052]  Cytokines   Interleukins    103286786 (IL12A) Glycosaminoglycan binding proteins [BR:efus00536]  Heparan sulfate / Heparin   Cytokines    103286786 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 nsP3_ZBD Motif Other DBs NCBI-GeneID:  103286786 NCBI-ProteinID:  XP_054566991 LinkDB All DBs Position 3:23967059..23974482 Genome browser AA seq 220 aa AA seqDB search MRPPRSLLLVVPLVLLHHLSLARNLPTAATAGPGTFPCLGLAQNLLKAVSSTLHKTRQTL EFYSCTSEEIDHEDITKDKTSTVEACLPLELTTNENCLVSREIAIITNGSCLASRKASFM TTLCLSSIYEDLKMYQVEFKAMNAKLLMEPKRQIILDQNMLTAIDELMQALNLNSAAVPQ NHPLEELDLYKTKVKLCILLHAFRIRAVTIDRMMSYLNSS NT seq 663 nt NT seq  +upstreamnt  +downstreamnt atgcgccccccgcgcagcctcctcctggtagtccctctggtcctcctacatcacctcagc ttggccaggaacctccccaccgcagccacagcaggccctggaacgttcccgtgcctgggc ctcgcccagaacctgctgaaggccgtcagcagcacgctgcacaagaccagacaaacgtta gaattttactcttgcacctctgaagagattgatcatgaagatatcacaaaagacaaaacc agcaccgtagaagcctgcctaccactggaattaaccacgaatgagaattgcctggtttcc agggagatcgctatcataactaatgggagttgcctggcctccagaaaggcctcttttatg acgaccctgtgcctgagtagtatctatgaggacttgaagatgtaccaggtggagttcaag gccatgaacgcaaagcttctgatggagcctaagaggcagatcattctggatcaaaacatg ttgacagctattgatgagctgatgcaggccctgaacctcaacagtgcggctgtgcctcaa aaccaccccctcgaagaactggatctttacaagacgaaagtcaagctctgcatccttctc cacgcgttccgaatccgcgcagtgactatcgacaggatgatgagctatctgaattcttcc taa

DBGET integrated database retrieval system