KEGG   Eptesicus fuscus (big brown bat): 103287001
Entry
103287001         CDS       T09083                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
efus  Eptesicus fuscus (big brown bat)
Pathway
efus01521  EGFR tyrosine kinase inhibitor resistance
efus01522  Endocrine resistance
efus01524  Platinum drug resistance
efus04010  MAPK signaling pathway
efus04012  ErbB signaling pathway
efus04014  Ras signaling pathway
efus04015  Rap1 signaling pathway
efus04022  cGMP-PKG signaling pathway
efus04024  cAMP signaling pathway
efus04062  Chemokine signaling pathway
efus04066  HIF-1 signaling pathway
efus04068  FoxO signaling pathway
efus04071  Sphingolipid signaling pathway
efus04072  Phospholipase D signaling pathway
efus04114  Oocyte meiosis
efus04140  Autophagy - animal
efus04148  Efferocytosis
efus04150  mTOR signaling pathway
efus04151  PI3K-Akt signaling pathway
efus04210  Apoptosis
efus04218  Cellular senescence
efus04261  Adrenergic signaling in cardiomyocytes
efus04270  Vascular smooth muscle contraction
efus04350  TGF-beta signaling pathway
efus04360  Axon guidance
efus04370  VEGF signaling pathway
efus04371  Apelin signaling pathway
efus04380  Osteoclast differentiation
efus04510  Focal adhesion
efus04520  Adherens junction
efus04540  Gap junction
efus04550  Signaling pathways regulating pluripotency of stem cells
efus04611  Platelet activation
efus04613  Neutrophil extracellular trap formation
efus04620  Toll-like receptor signaling pathway
efus04621  NOD-like receptor signaling pathway
efus04625  C-type lectin receptor signaling pathway
efus04650  Natural killer cell mediated cytotoxicity
efus04657  IL-17 signaling pathway
efus04658  Th1 and Th2 cell differentiation
efus04659  Th17 cell differentiation
efus04660  T cell receptor signaling pathway
efus04662  B cell receptor signaling pathway
efus04664  Fc epsilon RI signaling pathway
efus04666  Fc gamma R-mediated phagocytosis
efus04668  TNF signaling pathway
efus04713  Circadian entrainment
efus04720  Long-term potentiation
efus04722  Neurotrophin signaling pathway
efus04723  Retrograde endocannabinoid signaling
efus04724  Glutamatergic synapse
efus04725  Cholinergic synapse
efus04726  Serotonergic synapse
efus04730  Long-term depression
efus04810  Regulation of actin cytoskeleton
efus04910  Insulin signaling pathway
efus04912  GnRH signaling pathway
efus04914  Progesterone-mediated oocyte maturation
efus04915  Estrogen signaling pathway
efus04916  Melanogenesis
efus04917  Prolactin signaling pathway
efus04919  Thyroid hormone signaling pathway
efus04921  Oxytocin signaling pathway
efus04926  Relaxin signaling pathway
efus04928  Parathyroid hormone synthesis, secretion and action
efus04929  GnRH secretion
efus04930  Type II diabetes mellitus
efus04933  AGE-RAGE signaling pathway in diabetic complications
efus04934  Cushing syndrome
efus04935  Growth hormone synthesis, secretion and action
efus04960  Aldosterone-regulated sodium reabsorption
efus05010  Alzheimer disease
efus05020  Prion disease
efus05022  Pathways of neurodegeneration - multiple diseases
efus05034  Alcoholism
efus05132  Salmonella infection
efus05133  Pertussis
efus05135  Yersinia infection
efus05140  Leishmaniasis
efus05142  Chagas disease
efus05145  Toxoplasmosis
efus05152  Tuberculosis
efus05160  Hepatitis C
efus05161  Hepatitis B
efus05163  Human cytomegalovirus infection
efus05164  Influenza A
efus05165  Human papillomavirus infection
efus05166  Human T-cell leukemia virus 1 infection
efus05167  Kaposi sarcoma-associated herpesvirus infection
efus05170  Human immunodeficiency virus 1 infection
efus05171  Coronavirus disease - COVID-19
efus05200  Pathways in cancer
efus05203  Viral carcinogenesis
efus05205  Proteoglycans in cancer
efus05206  MicroRNAs in cancer
efus05207  Chemical carcinogenesis - receptor activation
efus05208  Chemical carcinogenesis - reactive oxygen species
efus05210  Colorectal cancer
efus05211  Renal cell carcinoma
efus05212  Pancreatic cancer
efus05213  Endometrial cancer
efus05214  Glioma
efus05215  Prostate cancer
efus05216  Thyroid cancer
efus05218  Melanoma
efus05219  Bladder cancer
efus05220  Chronic myeloid leukemia
efus05221  Acute myeloid leukemia
efus05223  Non-small cell lung cancer
efus05224  Breast cancer
efus05225  Hepatocellular carcinoma
efus05226  Gastric cancer
efus05230  Central carbon metabolism in cancer
efus05231  Choline metabolism in cancer
efus05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
efus05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:efus00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103287001 (MAPK1)
   04012 ErbB signaling pathway
    103287001 (MAPK1)
   04014 Ras signaling pathway
    103287001 (MAPK1)
   04015 Rap1 signaling pathway
    103287001 (MAPK1)
   04350 TGF-beta signaling pathway
    103287001 (MAPK1)
   04370 VEGF signaling pathway
    103287001 (MAPK1)
   04371 Apelin signaling pathway
    103287001 (MAPK1)
   04668 TNF signaling pathway
    103287001 (MAPK1)
   04066 HIF-1 signaling pathway
    103287001 (MAPK1)
   04068 FoxO signaling pathway
    103287001 (MAPK1)
   04072 Phospholipase D signaling pathway
    103287001 (MAPK1)
   04071 Sphingolipid signaling pathway
    103287001 (MAPK1)
   04024 cAMP signaling pathway
    103287001 (MAPK1)
   04022 cGMP-PKG signaling pathway
    103287001 (MAPK1)
   04151 PI3K-Akt signaling pathway
    103287001 (MAPK1)
   04150 mTOR signaling pathway
    103287001 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103287001 (MAPK1)
   04148 Efferocytosis
    103287001 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103287001 (MAPK1)
   04210 Apoptosis
    103287001 (MAPK1)
   04218 Cellular senescence
    103287001 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103287001 (MAPK1)
   04520 Adherens junction
    103287001 (MAPK1)
   04540 Gap junction
    103287001 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    103287001 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103287001 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103287001 (MAPK1)
   04613 Neutrophil extracellular trap formation
    103287001 (MAPK1)
   04620 Toll-like receptor signaling pathway
    103287001 (MAPK1)
   04621 NOD-like receptor signaling pathway
    103287001 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    103287001 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    103287001 (MAPK1)
   04660 T cell receptor signaling pathway
    103287001 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    103287001 (MAPK1)
   04659 Th17 cell differentiation
    103287001 (MAPK1)
   04657 IL-17 signaling pathway
    103287001 (MAPK1)
   04662 B cell receptor signaling pathway
    103287001 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    103287001 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    103287001 (MAPK1)
   04062 Chemokine signaling pathway
    103287001 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103287001 (MAPK1)
   04929 GnRH secretion
    103287001 (MAPK1)
   04912 GnRH signaling pathway
    103287001 (MAPK1)
   04915 Estrogen signaling pathway
    103287001 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    103287001 (MAPK1)
   04917 Prolactin signaling pathway
    103287001 (MAPK1)
   04921 Oxytocin signaling pathway
    103287001 (MAPK1)
   04926 Relaxin signaling pathway
    103287001 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    103287001 (MAPK1)
   04919 Thyroid hormone signaling pathway
    103287001 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    103287001 (MAPK1)
   04916 Melanogenesis
    103287001 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103287001 (MAPK1)
   04270 Vascular smooth muscle contraction
    103287001 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    103287001 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    103287001 (MAPK1)
   04725 Cholinergic synapse
    103287001 (MAPK1)
   04726 Serotonergic synapse
    103287001 (MAPK1)
   04720 Long-term potentiation
    103287001 (MAPK1)
   04730 Long-term depression
    103287001 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    103287001 (MAPK1)
   04722 Neurotrophin signaling pathway
    103287001 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    103287001 (MAPK1)
   04380 Osteoclast differentiation
    103287001 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    103287001 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103287001 (MAPK1)
   05206 MicroRNAs in cancer
    103287001 (MAPK1)
   05205 Proteoglycans in cancer
    103287001 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    103287001 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    103287001 (MAPK1)
   05203 Viral carcinogenesis
    103287001 (MAPK1)
   05230 Central carbon metabolism in cancer
    103287001 (MAPK1)
   05231 Choline metabolism in cancer
    103287001 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103287001 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103287001 (MAPK1)
   05212 Pancreatic cancer
    103287001 (MAPK1)
   05225 Hepatocellular carcinoma
    103287001 (MAPK1)
   05226 Gastric cancer
    103287001 (MAPK1)
   05214 Glioma
    103287001 (MAPK1)
   05216 Thyroid cancer
    103287001 (MAPK1)
   05221 Acute myeloid leukemia
    103287001 (MAPK1)
   05220 Chronic myeloid leukemia
    103287001 (MAPK1)
   05218 Melanoma
    103287001 (MAPK1)
   05211 Renal cell carcinoma
    103287001 (MAPK1)
   05219 Bladder cancer
    103287001 (MAPK1)
   05215 Prostate cancer
    103287001 (MAPK1)
   05213 Endometrial cancer
    103287001 (MAPK1)
   05224 Breast cancer
    103287001 (MAPK1)
   05223 Non-small cell lung cancer
    103287001 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103287001 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    103287001 (MAPK1)
   05161 Hepatitis B
    103287001 (MAPK1)
   05160 Hepatitis C
    103287001 (MAPK1)
   05171 Coronavirus disease - COVID-19
    103287001 (MAPK1)
   05164 Influenza A
    103287001 (MAPK1)
   05163 Human cytomegalovirus infection
    103287001 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103287001 (MAPK1)
   05165 Human papillomavirus infection
    103287001 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103287001 (MAPK1)
   05135 Yersinia infection
    103287001 (MAPK1)
   05133 Pertussis
    103287001 (MAPK1)
   05152 Tuberculosis
    103287001 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    103287001 (MAPK1)
   05140 Leishmaniasis
    103287001 (MAPK1)
   05142 Chagas disease
    103287001 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103287001 (MAPK1)
   05020 Prion disease
    103287001 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    103287001 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    103287001 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103287001 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103287001 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    103287001 (MAPK1)
   04934 Cushing syndrome
    103287001 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103287001 (MAPK1)
   01524 Platinum drug resistance
    103287001 (MAPK1)
   01522 Endocrine resistance
    103287001 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:efus01001]
    103287001 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:efus03036]
    103287001 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:efus04147]
    103287001 (MAPK1)
Enzymes [BR:efus01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     103287001 (MAPK1)
Protein kinases [BR:efus01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   103287001 (MAPK1)
Chromosome and associated proteins [BR:efus03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     103287001 (MAPK1)
Exosome [BR:efus04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103287001 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Choline_kinase FTA2 Kdo
Other DBs
NCBI-GeneID: 103287001
NCBI-ProteinID: XP_008140865
LinkDB
Position
23:12199031..12285646
AA seq 360 aa
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggcggcgggcgcgggcccggagatggtccgcgggcaggtgttcgac
gtggggccgcgctacaccaacctctcgtacattggcgagggcgcctacggcatggtgtgc
tctgcttatgataatgtcaacaaagttcgagtagctatcaagaaaatcagtccttttgaa
caccagacctactgccagagaaccctgagggagataaaaatcctactgcgcttcagacac
gagaacatcattggaatcaatgatattattcgagcgccaaccatcgagcaaatgaaagat
gtatatatagtacaggacctcatggaaacagatctctacaagctcttgaagacacaacac
ctcagcaacgaccatatctgctattttctttaccagatcctcagagggttaaaatatatc
cattcagctaacgtactgcaccgtgacctcaaaccttccaacctgctgctcaacaccacc
tgtgatctcaagatctgtgattttggcttggcccgcgttgcagatccagaccatgatcac
acagggttcttgacagagtatgtagccacacgttggtacagggctccagagattatgttg
aattccaagggctataccaagtccattgatatttggtctgtaggctgcattctggcagag
atgctctccaacaggcccatcttcccagggaagcattaccttgaccagctgaaccacatt
ctgggtattcttggatccccatcacaggaagacctgaactgcataatcaatctaaaagct
agaaactatttgctttctctcccacacaaaaataaggtgccatggaacaggctgttccca
aatgctgattccaaagctctggatttactggacaaaatgttgaccttcaaccctcacaag
aggattgaagtggaacaagcgctagcccacccgtatctggagcagtattatgacccaagt
gatgagcccatcgctgaagcaccattcaagtttgacatggaattggatgacttgcctaag
gagaagctcaaagaactcatttttgaagagactgctagattccagcctggatatagatct
taa

DBGET integrated database retrieval system