Eptesicus fuscus (big brown bat): 103287584 Help Entry 103287584         CDS       T09083                                  Symbol IL2 Name (RefSeq) interleukin-2   KO K05429   interleukin 2 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04060   Cytokine-cytokine receptor interaction efus04061   Viral protein interaction with cytokine and cytokine receptor efus04151   PI3K-Akt signaling pathway efus04625   C-type lectin receptor signaling pathway efus04630   JAK-STAT signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04672   Intestinal immune network for IgA production efus04940   Type I diabetes mellitus efus05135   Yersinia infection efus05142   Chagas disease efus05162   Measles efus05166   Human T-cell leukemia virus 1 infection efus05171   Coronavirus disease efus05200   Pathways in cancer efus05320   Autoimmune thyroid disease efus05321   Inflammatory bowel disease efus05330   Allograft rejection efus05332   Graft-versus-host disease Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     103287584 (IL2)    04151 PI3K-Akt signaling pathway     103287584 (IL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103287584 (IL2)    04061 Viral protein interaction with cytokine and cytokine receptor     103287584 (IL2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103287584 (IL2)    04660 T cell receptor signaling pathway     103287584 (IL2)    04658 Th1 and Th2 cell differentiation     103287584 (IL2)    04659 Th17 cell differentiation     103287584 (IL2)    04672 Intestinal immune network for IgA production     103287584 (IL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103287584 (IL2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103287584 (IL2)    05171 Coronavirus disease     103287584 (IL2)    05162 Measles     103287584 (IL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     103287584 (IL2)   09174 Infectious disease: parasitic    05142 Chagas disease     103287584 (IL2)   09163 Immune disease    05320 Autoimmune thyroid disease     103287584 (IL2)    05321 Inflammatory bowel disease     103287584 (IL2)    05330 Allograft rejection     103287584 (IL2)    05332 Graft-versus-host disease     103287584 (IL2)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     103287584 (IL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103287584 (IL2)    00536 Glycosaminoglycan binding proteins [BR:efus00536]     103287584 (IL2) Cytokines and neuropeptides [BR:efus04052]  Cytokines   Interleukins    103287584 (IL2) Glycosaminoglycan binding proteins [BR:efus00536]  Heparan sulfate / Heparin   Cytokines    103287584 (IL2) SSDB OrthologParalogGFIT Motif Pfam:  IL2 CDK5RAP3 SYN8_N DISC1 DUF4264 GVIN1_N Motif Other DBs NCBI-GeneID:  103287584 NCBI-ProteinID:  XP_008141498 LinkDB All DBs Position 6:69325135..69330515 Genome browser AA seq 152 aa AA seqDB search MYKMHFLSCIALTLAFIADGAPTSRSSQETQQQLEQLILDLQRLLNGVRNDKNSKLPMML TFKFYMPRNATELKHLQCLVEEHEALEKVLKLDQSKSLSNITELMSNVNVLAQNLKGPET RFKCDDDDETVNIVDFLNKWITFCQRIVSTLT NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtacaagatgcacttcttgtcttgtattgcactaactctcgcattcatcgcagacggt gcacctacctcgaggtccagtcaggaaacacagcagcagctggagcaactgatactggat ctgcagcggcttctgaatggagtcaggaatgacaagaactccaaactccccatgatgctc acgtttaagttttacatgcccaggaatgccacagaattgaaacatctgcagtgtctagtc gaagaacatgaagctctggagaaagtgctaaagttagatcaaagcaaaagcttgagcaat atcacggaattaatgagcaatgtcaatgtactcgctcagaacctgaagggacctgaaacg agattcaaatgtgacgatgatgatgagacggtgaacatcgtagacttcctgaacaagtgg attaccttttgtcaaagaatcgtctcaacactgacttaa

DBGET integrated database retrieval system