Eptesicus fuscus (big brown bat): 103287782 Help Entry 103287782         CDS       T09083                                  Name (RefSeq) c-Myc-binding protein-like   KO K25550   c-Myc-binding protein Organism efus  Eptesicus fuscus (big brown bat) Brite KEGG Orthology (KO) [BR:efus00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:efus03037]     103287782 Cilium and associated proteins [BR:efus03037]  Motile cilia and associated proteins   Sperm associated proteins    103287782 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TSC22 ZapB DivIC YabA Motif Other DBs NCBI-GeneID:  103287782 NCBI-ProteinID:  XP_054579314 LinkDB All DBs Position 11:complement(7330898..7331257) Genome browser AA seq 102 aa AA seqDB search MAHYKATDSKCEQFRRYLDKSGVLDTLTTVLVALYEEPEKPKSALDFLKHHLGAATPENP EIELLRLELAEMKEKYEAIVEENKKLKARLAQYEPSQEKHAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcccattacaaagccaccgactcgaagtgcgagcagttccggaggtacttggacaag tcaggagtgctggacacgctgaccacggtactggtagccttatatgaagaaccagagaaa cctaagagtgctttggattttttaaagcatcacttgggagctgctaccccagaaaatcca gaaatagagctgcttcgtctggaattggcagaaatgaaagagaaatatgaagctattgta gaagaaaataaaaaactgaaagcaaggcttgctcagtatgaaccatctcaggagaagcat gctgaatag

DBGET integrated database retrieval system