Eptesicus fuscus (big brown bat): 103288747 Help Entry 103288747         CDS       T09083                                  Name (RefSeq) probable protein BRICK1   KO K05752   chromosome 3 open reading frame 10 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04810   Regulation of actin cytoskeleton efus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:efus00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103288747  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103288747 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dodecin DUF7310 Motif Other DBs NCBI-GeneID:  103288747 NCBI-ProteinID:  XP_054570261 LinkDB All DBs Position 4:55485997..55486206 Genome browser AA seq 69 aa AA seqDB search MKGQDDPVQGQIHQDLVNPEYIEVITTTSRKSFYMACRSRLTTMNDKLKALEWRIEDIEA HVTKGETLT NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaagggacaagatgaccctgtgcagggacaaattcatcaggacttggtgaacccagag tacattgaggtcatcaccacaacatcaagaaaatcattctatatggcttgtcgctcaaga ctcacaacaatgaatgataaattgaaagcccttgaatggagaatagaggacattgaagca catgtgacgaaaggtgagaccctcacctag

DBGET integrated database retrieval system