Eptesicus fuscus (big brown bat): 103289362 Help Entry 103289362         CDS       T09083                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04081   Hormone signaling efus04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     103289362 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     103289362 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103289362 (GAST) Cytokines and neuropeptides [BR:efus04052]  Neuropeptides   GPCR binding    103289362 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  103289362 NCBI-ProteinID:  XP_054565799 LinkDB All DBs Position 20:44255393..44255815 Genome browser AA seq 102 aa AA seqDB search MQRLCVCALLLALALATFSEASWKPRSQLQDAPSGPGAKRALEARWLDQLGPAPPHQRQL RFQDPPHPVADLSKKQGPWLEEEEEAYGWMDFGRRSAEEGDQ NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcagcgactgtgcgtgtgtgcgctgctcctggctctggcgctggccaccttctctgaa gcctcttggaagccccgctcccagctgcaggatgcaccctcgggcccaggcgccaagagg gccctggaggcacgttggctggaccagctgggcccagcccctccccaccaaaggcagctg aggttccaggatcctccacaccctgtagcagacctgtccaagaagcaggggccgtggctg gaggaagaagaagaagcgtacggatggatggacttcggccgccgcagtgctgaggaaggg gaccaatag

DBGET integrated database retrieval system