KEGG   Eptesicus fuscus (big brown bat): 103290824
Entry
103290824         CDS       T09083                                 
Symbol
NDUFS3
Name
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2]
Organism
efus  Eptesicus fuscus (big brown bat)
Pathway
efus00190  Oxidative phosphorylation
efus01100  Metabolic pathways
efus04714  Thermogenesis
efus04723  Retrograde endocannabinoid signaling
efus04932  Non-alcoholic fatty liver disease
efus05010  Alzheimer disease
efus05012  Parkinson disease
efus05014  Amyotrophic lateral sclerosis
efus05016  Huntington disease
efus05020  Prion disease
efus05022  Pathways of neurodegeneration - multiple diseases
efus05208  Chemical carcinogenesis - reactive oxygen species
efus05415  Diabetic cardiomyopathy
Module
efus_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:efus00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103290824 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    103290824 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    103290824 (NDUFS3)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    103290824 (NDUFS3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103290824 (NDUFS3)
   05012 Parkinson disease
    103290824 (NDUFS3)
   05014 Amyotrophic lateral sclerosis
    103290824 (NDUFS3)
   05016 Huntington disease
    103290824 (NDUFS3)
   05020 Prion disease
    103290824 (NDUFS3)
   05022 Pathways of neurodegeneration - multiple diseases
    103290824 (NDUFS3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    103290824 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    103290824 (NDUFS3)
Enzymes [BR:efus01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     103290824 (NDUFS3)
SSDB
Motif
Pfam: Complex1_30kDa
Other DBs
NCBI-GeneID: 103290824
NCBI-ProteinID: XP_008144942
LinkDB
Position
13:complement(67201913..67206962)
AA seq 262 aa
MAAAAGAWCRGLVGAVALPRVVGRSSALLLPVRRESAAADKRPTVRPRDDVAHKQLSAFG
EYVAEILPKYIQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDIPTR
QNRFEIVYNLLSLRFNSRIRVKTYTDELTPIESTVSVYKAANWYEREIWDMFGVFFANHP
DLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPIELAQEFRKFDLNSPWEAF
PAYRQPPESLKLEAGDKKPETK
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcggccgccgctggggcctggtgccgagggctcgtgggggccgtggcgctgcccagg
gtggttggacggtcctcggcgctgttgctgccggtgaggagggaaagcgctgcggccgac
aagcgccccactgtcagaccacgggatgatgtggcccacaaacagctctcagcttttgga
gagtatgtagctgaaatcctgcccaagtatatccaacaagttcaggtgtcctgcttcaat
gagttagagatctgtatccatcctgatggagtcattccagtgctgactttcctcagggat
cacaccaatgcacaattcaaatccttggctgacttgacagcagtggacatcccaacccgg
cagaaccgttttgagattgtttacaacctgctgtctctgcgattcaactcgcgcatccgt
gtgaagacctatacagatgagctgacacccattgagtccactgtctctgtgtataaggca
gcaaactggtacgaaagggagatctgggacatgtttggagtcttctttgctaaccaccct
gacctaagaaggatcctgacagactatggctttgaaggacatcctttccggaaagacttc
cccctgtctggctacgttgagttacgctatgatgatgaagtgaagcgtgtggtggctgag
ccgatagaattggcccaagagttccgaaagtttgacctaaatagcccatgggaggctttc
cctgcctatcgccagccccctgagagtctcaagctggaagccggagacaagaaacccgaa
accaagtag

DBGET integrated database retrieval system