Eptesicus fuscus (big brown bat): 103291198 Help Entry 103291198         CDS       T09083                                  Name (RefSeq) histone H3.3A-like   KO K11253   histone H3 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04613   Neutrophil extracellular trap formation efus05034   Alcoholism efus05202   Transcriptional misregulation in cancer efus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103291198  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103291198   09163 Immune disease    05322 Systemic lupus erythematosus     103291198   09165 Substance dependence    05034 Alcoholism     103291198  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     103291198   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103291198 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103291198 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103291198 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF Motif Other DBs NCBI-GeneID:  103291198 NCBI-ProteinID:  XP_008145398 LinkDB All DBs Position 22:complement(8077383..8077843) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTEGKAPRKQLATKAARKSAPSTGGVKRPHRYRPGTVALPEIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCALHAKRVTI MPTDTQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagactgcccgcaaatcgaccgagggcaaagccccgaggaagcag ctggctaccaaagccgctcgaaagagtgcgccctccactggaggggtgaagagacctcat cgttacaggcccggtaccgtggcacttcctgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccaaagtgcagcgattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctctccatgccaaacgtgtaacaatt atgccaacagacacccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system