Eptesicus fuscus (big brown bat): 103291212 Help Entry 103291212         CDS       T09083                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism efus  Eptesicus fuscus (big brown bat) Pathway efus01521   EGFR tyrosine kinase inhibitor resistance efus01522   Endocrine resistance efus04010   MAPK signaling pathway efus04012   ErbB signaling pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04062   Chemokine signaling pathway efus04068   FoxO signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04137   Mitophagy - animal efus04140   Autophagy - animal efus04150   mTOR signaling pathway efus04151   PI3K-Akt signaling pathway efus04210   Apoptosis efus04211   Longevity regulating pathway efus04213   Longevity regulating pathway - multiple species efus04218   Cellular senescence efus04360   Axon guidance efus04370   VEGF signaling pathway efus04371   Apelin signaling pathway efus04540   Gap junction efus04550   Signaling pathways regulating pluripotency of stem cells efus04625   C-type lectin receptor signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04664   Fc epsilon RI signaling pathway efus04714   Thermogenesis efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04725   Cholinergic synapse efus04726   Serotonergic synapse efus04730   Long-term depression efus04810   Regulation of actin cytoskeleton efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04917   Prolactin signaling pathway efus04919   Thyroid hormone signaling pathway efus04921   Oxytocin signaling pathway efus04926   Relaxin signaling pathway efus04929   GnRH secretion efus04933   AGE-RAGE signaling pathway in diabetic complications efus04935   Growth hormone synthesis, secretion and action efus05010   Alzheimer disease efus05022   Pathways of neurodegeneration - multiple diseases efus05034   Alcoholism efus05160   Hepatitis C efus05161   Hepatitis B efus05163   Human cytomegalovirus infection efus05165   Human papillomavirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05207   Chemical carcinogenesis - receptor activation efus05208   Chemical carcinogenesis - reactive oxygen species efus05210   Colorectal cancer efus05211   Renal cell carcinoma efus05213   Endometrial cancer efus05214   Glioma efus05215   Prostate cancer efus05216   Thyroid cancer efus05218   Melanoma efus05219   Bladder cancer efus05220   Chronic myeloid leukemia efus05221   Acute myeloid leukemia efus05223   Non-small cell lung cancer efus05224   Breast cancer efus05225   Hepatocellular carcinoma efus05226   Gastric cancer efus05230   Central carbon metabolism in cancer efus05231   Choline metabolism in cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103291212 (NRAS)    04012 ErbB signaling pathway     103291212 (NRAS)    04014 Ras signaling pathway     103291212 (NRAS)    04015 Rap1 signaling pathway     103291212 (NRAS)    04370 VEGF signaling pathway     103291212 (NRAS)    04371 Apelin signaling pathway     103291212 (NRAS)    04068 FoxO signaling pathway     103291212 (NRAS)    04072 Phospholipase D signaling pathway     103291212 (NRAS)    04071 Sphingolipid signaling pathway     103291212 (NRAS)    04151 PI3K-Akt signaling pathway     103291212 (NRAS)    04150 mTOR signaling pathway     103291212 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103291212 (NRAS)    04137 Mitophagy - animal     103291212 (NRAS)   09143 Cell growth and death    04210 Apoptosis     103291212 (NRAS)    04218 Cellular senescence     103291212 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     103291212 (NRAS)    04550 Signaling pathways regulating pluripotency of stem cells     103291212 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103291212 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103291212 (NRAS)    04650 Natural killer cell mediated cytotoxicity     103291212 (NRAS)    04660 T cell receptor signaling pathway     103291212 (NRAS)    04662 B cell receptor signaling pathway     103291212 (NRAS)    04664 Fc epsilon RI signaling pathway     103291212 (NRAS)    04062 Chemokine signaling pathway     103291212 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     103291212 (NRAS)    04929 GnRH secretion     103291212 (NRAS)    04912 GnRH signaling pathway     103291212 (NRAS)    04915 Estrogen signaling pathway     103291212 (NRAS)    04917 Prolactin signaling pathway     103291212 (NRAS)    04921 Oxytocin signaling pathway     103291212 (NRAS)    04926 Relaxin signaling pathway     103291212 (NRAS)    04935 Growth hormone synthesis, secretion and action     103291212 (NRAS)    04919 Thyroid hormone signaling pathway     103291212 (NRAS)    04916 Melanogenesis     103291212 (NRAS)   09156 Nervous system    04725 Cholinergic synapse     103291212 (NRAS)    04726 Serotonergic synapse     103291212 (NRAS)    04720 Long-term potentiation     103291212 (NRAS)    04730 Long-term depression     103291212 (NRAS)    04722 Neurotrophin signaling pathway     103291212 (NRAS)   09158 Development and regeneration    04360 Axon guidance     103291212 (NRAS)   09149 Aging    04211 Longevity regulating pathway     103291212 (NRAS)    04213 Longevity regulating pathway - multiple species     103291212 (NRAS)   09159 Environmental adaptation    04714 Thermogenesis     103291212 (NRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103291212 (NRAS)    05206 MicroRNAs in cancer     103291212 (NRAS)    05205 Proteoglycans in cancer     103291212 (NRAS)    05207 Chemical carcinogenesis - receptor activation     103291212 (NRAS)    05208 Chemical carcinogenesis - reactive oxygen species     103291212 (NRAS)    05203 Viral carcinogenesis     103291212 (NRAS)    05230 Central carbon metabolism in cancer     103291212 (NRAS)    05231 Choline metabolism in cancer     103291212 (NRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103291212 (NRAS)   09162 Cancer: specific types    05210 Colorectal cancer     103291212 (NRAS)    05225 Hepatocellular carcinoma     103291212 (NRAS)    05226 Gastric cancer     103291212 (NRAS)    05214 Glioma     103291212 (NRAS)    05216 Thyroid cancer     103291212 (NRAS)    05221 Acute myeloid leukemia     103291212 (NRAS)    05220 Chronic myeloid leukemia     103291212 (NRAS)    05218 Melanoma     103291212 (NRAS)    05211 Renal cell carcinoma     103291212 (NRAS)    05219 Bladder cancer     103291212 (NRAS)    05215 Prostate cancer     103291212 (NRAS)    05213 Endometrial cancer     103291212 (NRAS)    05224 Breast cancer     103291212 (NRAS)    05223 Non-small cell lung cancer     103291212 (NRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103291212 (NRAS)    05170 Human immunodeficiency virus 1 infection     103291212 (NRAS)    05161 Hepatitis B     103291212 (NRAS)    05160 Hepatitis C     103291212 (NRAS)    05163 Human cytomegalovirus infection     103291212 (NRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     103291212 (NRAS)    05165 Human papillomavirus infection     103291212 (NRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     103291212 (NRAS)    05022 Pathways of neurodegeneration - multiple diseases     103291212 (NRAS)   09165 Substance dependence    05034 Alcoholism     103291212 (NRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103291212 (NRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103291212 (NRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103291212 (NRAS)    01522 Endocrine resistance     103291212 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103291212 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103291212 (NRAS)    04031 GTP-binding proteins [BR:efus04031]     103291212 (NRAS) Membrane trafficking [BR:efus04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     103291212 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     103291212 (NRAS) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103291212 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    103291212 (NRAS)   Exosomal proteins of breast cancer cells    103291212 (NRAS)   Exosomal proteins of colorectal cancer cells    103291212 (NRAS) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     103291212 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  103291212 NCBI-ProteinID:  XP_008145417 LinkDB All DBs Position 22:complement(8945378..8961357) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG CMGLPCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcgctgaca atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac cgaaaacaggtggtcatagatggtgagacctgtctgttggatatactggacacggctgga caagaggagtacagtgccatgcgggaccaatacatgaggacaggggaaggtttcctctgt gtgttcgccatcaataatagcaagtcatttgcagacattaacctctacagggaacaaatt aagcgagtgaaggactcagatgatgtaccgatggtgctagtaggaaacaagtgtgattta ccaacaaggacagttgacacgaaacaagcccatgaactggccaagagttatgggattcca ttcattgaaacctcagccaagaccagacagggtgttgaagatgccttttacacactggta agagaaatacgtcagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt tgcatggggctgccttgtgtggtgatgtaa

DBGET integrated database retrieval system