Eptesicus fuscus (big brown bat): 103291470 Help Entry 103291470         CDS       T09083                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04010   MAPK signaling pathway efus04020   Calcium signaling pathway efus04022   cGMP-PKG signaling pathway efus04114   Oocyte meiosis efus04218   Cellular senescence efus04310   Wnt signaling pathway efus04360   Axon guidance efus04370   VEGF signaling pathway efus04380   Osteoclast differentiation efus04625   C-type lectin receptor signaling pathway efus04650   Natural killer cell mediated cytotoxicity efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04720   Long-term potentiation efus04724   Glutamatergic synapse efus04921   Oxytocin signaling pathway efus04922   Glucagon signaling pathway efus04924   Renin secretion efus05010   Alzheimer disease efus05014   Amyotrophic lateral sclerosis efus05020   Prion disease efus05022   Pathways of neurodegeneration - multiple diseases efus05031   Amphetamine addiction efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     103291470 (PPP3R1)    04310 Wnt signaling pathway     103291470 (PPP3R1)    04370 VEGF signaling pathway     103291470 (PPP3R1)    04020 Calcium signaling pathway     103291470 (PPP3R1)    04022 cGMP-PKG signaling pathway     103291470 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103291470 (PPP3R1)    04218 Cellular senescence     103291470 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103291470 (PPP3R1)    04650 Natural killer cell mediated cytotoxicity     103291470 (PPP3R1)    04660 T cell receptor signaling pathway     103291470 (PPP3R1)    04658 Th1 and Th2 cell differentiation     103291470 (PPP3R1)    04659 Th17 cell differentiation     103291470 (PPP3R1)    04662 B cell receptor signaling pathway     103291470 (PPP3R1)   09152 Endocrine system    04922 Glucagon signaling pathway     103291470 (PPP3R1)    04921 Oxytocin signaling pathway     103291470 (PPP3R1)    04924 Renin secretion     103291470 (PPP3R1)   09156 Nervous system    04724 Glutamatergic synapse     103291470 (PPP3R1)    04720 Long-term potentiation     103291470 (PPP3R1)   09158 Development and regeneration    04360 Axon guidance     103291470 (PPP3R1)    04380 Osteoclast differentiation     103291470 (PPP3R1)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103291470 (PPP3R1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103291470 (PPP3R1)    05170 Human immunodeficiency virus 1 infection     103291470 (PPP3R1)    05163 Human cytomegalovirus infection     103291470 (PPP3R1)    05167 Kaposi sarcoma-associated herpesvirus infection     103291470 (PPP3R1)   09171 Infectious disease: bacterial    05152 Tuberculosis     103291470 (PPP3R1)   09164 Neurodegenerative disease    05010 Alzheimer disease     103291470 (PPP3R1)    05014 Amyotrophic lateral sclerosis     103291470 (PPP3R1)    05020 Prion disease     103291470 (PPP3R1)    05022 Pathways of neurodegeneration - multiple diseases     103291470 (PPP3R1)   09165 Substance dependence    05031 Amphetamine addiction     103291470 (PPP3R1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103291470 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:efus01009]     103291470 (PPP3R1) Protein phosphatases and associated proteins [BR:efus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103291470 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  103291470 NCBI-ProteinID:  XP_054584406 LinkDB All DBs Position 16:complement(40702657..40761822) Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagttatcctttggaaatgtgctcacactttgatgctgatgaaatt aaaaggctaggaaagagatttaagaagcttgatttggacaattctggttctttgagtgtg gaagagttcatgtctctgccggagttacaacagaatcctttagtacaacgagtaatagat atattcgacacagatgggaatggagaagtagactttaaagaattcattgagggagtctct cagttcagtgtcaaaggcgataaggagcagaagttgaggtttgcttttcgtatctatgac atggataaagatggctatatttccaatggggaactcttccaggtgctgaagatgatggtg gggaacaatctgaaagatacgcagttacagcaaattgtagacaaaaccataataaatgca gataaggatggagatggaagaatatcctttgaagaattctgtgctgttgtaggtggccta gatatccacaaaaagatggtggtagatgtgtga

DBGET integrated database retrieval system