Eptesicus fuscus (big brown bat): 103293097 Help Entry 103293097         CDS       T09083                                  Symbol RAB5C Name (RefSeq) ras-related protein Rab-5C   KO K07889   Ras-related protein Rab-5C Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04014   Ras signaling pathway efus04137   Mitophagy - animal efus04144   Endocytosis efus04145   Phagosome efus04148   Efferocytosis efus04962   Vasopressin-regulated water reabsorption efus05132   Salmonella infection efus05146   Amoebiasis efus05152   Tuberculosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103293097 (RAB5C)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103293097 (RAB5C)    04145 Phagosome     103293097 (RAB5C)    04137 Mitophagy - animal     103293097 (RAB5C)    04148 Efferocytosis     103293097 (RAB5C)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     103293097 (RAB5C)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103293097 (RAB5C)    05152 Tuberculosis     103293097 (RAB5C)   09174 Infectious disease: parasitic    05146 Amoebiasis     103293097 (RAB5C)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103293097 (RAB5C)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103293097 (RAB5C)    04031 GTP-binding proteins [BR:efus04031]     103293097 (RAB5C) Membrane trafficking [BR:efus04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     103293097 (RAB5C)  Endosome - Lysosome transport     103293097 (RAB5C) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103293097 (RAB5C)   Exosomal proteins of other body fluids (saliva and urine)    103293097 (RAB5C)   Exosomal proteins of colorectal cancer cells    103293097 (RAB5C)   Exosomal proteins of bladder cancer cells    103293097 (RAB5C) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     103293097 (RAB5C) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase AAA_16 Motif Other DBs NCBI-GeneID:  103293097 NCBI-ProteinID:  XP_008147587 LinkDB All DBs Position 20:complement(35674069..35697216) Genome browser AA seq 216 aa AA seqDB search MAGRGGAARPNGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLT QTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQ RQASPNIVIALAGNKADLANKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAK KLPKNEPQNAAGAPGRNRGVDLQENNPASRSQCCSN NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcgggtcggggaggtgcagcacgacccaatggaccagctgctgggaacaagatctgt cagtttaagctagtcctgctgggggagtctgcagtaggcaaatccagccttgtcctccgc tttgtcaagggacaattccacgagtaccaggagagcacaattggagcggccttcctcaca cagactgtctgcttggacgacacaacagtcaagtttgagatctgggacacagccggacag gagcggtatcacagcctcgcccccatgtactatcggggggcccaggctgccatcgtggtc tatgacatcaccaacacagatacgttcgcacgggccaagaactgggtgaaggagttacag aggcaggccagtcccaacatcgtcatcgcgctggcgggtaacaaggcggacctggccaac aagagagccgtggaattccaggaagcacaagcctatgcagacgacaacagtttgctgttc atggagacatcagcaaagacagcaatgaatgtgaatgaaattttcatggcaatagctaag aagctccccaagaatgagccccagaatgcagctggtgctccgggccggaaccgaggtgtg gacctccaggagaacaacccagccagccggagccagtgctgcagcaactga

DBGET integrated database retrieval system