Eptesicus fuscus (big brown bat): 103293443 Help Entry 103293443         CDS       T09083                                  Name (RefSeq) histone H3.3A   KO K11253   histone H3 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04613   Neutrophil extracellular trap formation efus05034   Alcoholism efus05202   Transcriptional misregulation in cancer efus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103293443  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     103293443   09163 Immune disease    05322 Systemic lupus erythematosus     103293443   09165 Substance dependence    05034 Alcoholism     103293443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     103293443   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103293443 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103293443 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103293443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  103293443 NCBI-ProteinID:  XP_054568890 LinkDB All DBs Position 24:complement(5938542..5946514) Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtaccaagcagaccgcccgcaaatcgaccgggggcaaagccccgaggaagcag ctggccaccaaagccgctcgaaagagtgcgccctccactggaggggtgaagaaacctcat cgttacaggcccggtactgtggcacttcgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggacttcaaa acagacctgcgcttccaaagtgcagcgattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaaccatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system