Eptesicus fuscus (big brown bat): 103295254 Help Entry 103295254         CDS       T09083                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04022   cGMP-PKG signaling pathway efus04024   cAMP signaling pathway efus04062   Chemokine signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04081   Hormone signaling efus04144   Endocytosis efus04150   mTOR signaling pathway efus04270   Vascular smooth muscle contraction efus04310   Wnt signaling pathway efus04350   TGF-beta signaling pathway efus04360   Axon guidance efus04510   Focal adhesion efus04517   IgSF CAM signaling efus04519   Cadherin signaling efus04520   Adherens junction efus04530   Tight junction efus04611   Platelet activation efus04621   NOD-like receptor signaling pathway efus04625   C-type lectin receptor signaling pathway efus04660   T cell receptor signaling pathway efus04670   Leukocyte transendothelial migration efus04722   Neurotrophin signaling pathway efus04810   Regulation of actin cytoskeleton efus04921   Oxytocin signaling pathway efus04928   Parathyroid hormone synthesis, secretion and action efus04972   Pancreatic secretion efus05100   Bacterial invasion of epithelial cells efus05132   Salmonella infection efus05133   Pertussis efus05135   Yersinia infection efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05210   Colorectal cancer efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103295254    04015 Rap1 signaling pathway     103295254    04310 Wnt signaling pathway     103295254    04350 TGF-beta signaling pathway     103295254    04072 Phospholipase D signaling pathway     103295254    04071 Sphingolipid signaling pathway     103295254    04024 cAMP signaling pathway     103295254    04022 cGMP-PKG signaling pathway     103295254    04150 mTOR signaling pathway     103295254   09133 Signaling molecules and interaction    04081 Hormone signaling     103295254    04517 IgSF CAM signaling     103295254    04519 Cadherin signaling     103295254  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103295254   09144 Cellular community - eukaryotes    04510 Focal adhesion     103295254    04520 Adherens junction     103295254    04530 Tight junction     103295254   09142 Cell motility    04810 Regulation of actin cytoskeleton     103295254  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103295254    04621 NOD-like receptor signaling pathway     103295254    04625 C-type lectin receptor signaling pathway     103295254    04660 T cell receptor signaling pathway     103295254    04670 Leukocyte transendothelial migration     103295254    04062 Chemokine signaling pathway     103295254   09152 Endocrine system    04921 Oxytocin signaling pathway     103295254    04928 Parathyroid hormone synthesis, secretion and action     103295254   09153 Circulatory system    04270 Vascular smooth muscle contraction     103295254   09154 Digestive system    04972 Pancreatic secretion     103295254   09156 Nervous system    04722 Neurotrophin signaling pathway     103295254   09158 Development and regeneration    04360 Axon guidance     103295254  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103295254    05206 MicroRNAs in cancer     103295254    05205 Proteoglycans in cancer     103295254    05203 Viral carcinogenesis     103295254   09162 Cancer: specific types    05210 Colorectal cancer     103295254   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103295254   09171 Infectious disease: bacterial    05132 Salmonella infection     103295254    05135 Yersinia infection     103295254    05133 Pertussis     103295254    05152 Tuberculosis     103295254    05100 Bacterial invasion of epithelial cells     103295254   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103295254    05418 Fluid shear stress and atherosclerosis     103295254  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103295254   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103295254    04031 GTP-binding proteins [BR:efus04031]     103295254 Membrane trafficking [BR:efus04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103295254 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103295254   Exosomal proteins of other body fluids (saliva and urine)    103295254   Exosomal proteins of colorectal cancer cells    103295254   Exosomal proteins of bladder cancer cells    103295254 GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103295254 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB Motif Other DBs NCBI-GeneID:  103295254 NCBI-ProteinID:  XP_054585621 LinkDB All DBs Position 18:complement(38112995..38114393) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVMVGDGACGKTCLLIVFSKDQFPEAYRPMVSENYVADVEVDGRQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDNPDSLENIPEKWTPEVKHFCPRVPIVLVGNKKD LRNEERRRRELAKRKQEPVKPEEGREVANGIGAFGYVECSAKTKDGVREVFEMATRAALR GRRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggccgccatccggaagaagctggtgatggttggcgatggagcctgtggcaagacttgc ttgctgatcgttttcagcaaggaccagttcccggaggcgtacagaccgatggtgtctgag aactacgtggccgacgtggaagtggacggccggcaggtggagctggccttgtgggacacg gccgggcaggaggactatgatcgcttgaggcccctctcctacccggacacggacgtcatc ctgatgtgcttctccatcgacaaccctgatagtttagaaaacatcccggaaaaatggact ccggaagtcaagcatttctgtcccagggtgcccatcgtcctggttgggaacaagaaggat cttcgaaatgaggagcgcagaaggcgggagctggccaagaggaagcaggagccggtaaaa ccggaggaaggcagagaggtggccaacgggattggcgcttttgggtacgtggagtgttcg gcaaagaccaaagacggggtgagggaggttttcgaaatggccacgagagccgctctgcga ggcaggcgtgggaagaagaagtccgggtgccttgtgttgtga

DBGET integrated database retrieval system