Eptesicus fuscus (big brown bat): 103295927 Help Entry 103295927         CDS       T09083                                  Symbol CAV2 Name (RefSeq) caveolin-2 isoform X1   KO K12958   caveolin 2 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04144   Endocytosis efus04510   Focal adhesion efus05020   Prion disease efus05100   Bacterial invasion of epithelial cells efus05205   Proteoglycans in cancer efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103295927 (CAV2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103295927 (CAV2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103295927 (CAV2)   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103295927 (CAV2)   09164 Neurodegenerative disease    05020 Prion disease     103295927 (CAV2)   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     103295927 (CAV2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103295927 (CAV2) Membrane trafficking [BR:efus04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     103295927 (CAV2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin DUF7046 Motif Other DBs NCBI-GeneID:  103295927 NCBI-ProteinID:  XP_008150640 LinkDB All DBs Position 14:complement(73068808..73074853) Genome browser AA seq 162 aa AA seqDB search MGLETEKADVQLFMDEDAYSHHSGLDYAHPEKYVDSDPDRDPNQLNSHLKVDFQDVIAEP ESTHSFDKVWICSHALFEVSKYVIYKFLTVFLAIPLAFAAGILFATLSCLHIWIIMPFIK TCLMIQPSVQTIWKSVTDVVIAPLCMSAGRIFSSVSVQLSHD NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atggggctggagaccgagaaggcggacgtgcagctcttcatggacgaggacgcctacagc caccacagcggcctggactacgcccaccccgagaagtacgtggactcggacccggatcgg gatcccaaccagctcaactcgcatctcaaggtggacttccaggatgtgatcgcagagccc gagtccacgcactcctttgacaaggtgtggatctgcagccatgccctcttcgaagtcagc aaatacgtgatctacaagttcctgaccgtgttcctggctatcccgctggcctttgccgcg gggattctctttgccaccctcagctgtctgcacatctggattataatgccttttataaag acctgcctaatgatccagccttcagtgcagacaatctggaagagtgtgacagacgttgtc attgccccattgtgtatgagcgcaggacgcatcttctcttctgtcagcgtgcagctgagc cacgactga

DBGET integrated database retrieval system