Eptesicus fuscus (big brown bat): 103297029 Help Entry 103297029         CDS       T09083                                  Symbol CCL5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04060   Cytokine-cytokine receptor interaction efus04061   Viral protein interaction with cytokine and cytokine receptor efus04062   Chemokine signaling pathway efus04620   Toll-like receptor signaling pathway efus04621   NOD-like receptor signaling pathway efus04623   Cytosolic DNA-sensing pathway efus04668   TNF signaling pathway efus05020   Prion disease efus05142   Chagas disease efus05163   Human cytomegalovirus infection efus05164   Influenza A efus05168   Herpes simplex virus 1 infection efus05323   Rheumatoid arthritis efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     103297029 (CCL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103297029 (CCL5)    04061 Viral protein interaction with cytokine and cytokine receptor     103297029 (CCL5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103297029 (CCL5)    04621 NOD-like receptor signaling pathway     103297029 (CCL5)    04623 Cytosolic DNA-sensing pathway     103297029 (CCL5)    04062 Chemokine signaling pathway     103297029 (CCL5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     103297029 (CCL5)    05168 Herpes simplex virus 1 infection     103297029 (CCL5)    05163 Human cytomegalovirus infection     103297029 (CCL5)   09174 Infectious disease: parasitic    05142 Chagas disease     103297029 (CCL5)   09163 Immune disease    05323 Rheumatoid arthritis     103297029 (CCL5)   09164 Neurodegenerative disease    05020 Prion disease     103297029 (CCL5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103297029 (CCL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     103297029 (CCL5)    00536 Glycosaminoglycan binding proteins [BR:efus00536]     103297029 (CCL5) Cytokines and neuropeptides [BR:efus04052]  Cytokines   Chemokines    103297029 (CCL5) Glycosaminoglycan binding proteins [BR:efus00536]  Heparan sulfate / Heparin   Chemokines    103297029 (CCL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Hydrolase_4 Motif Other DBs NCBI-GeneID:  103297029 NCBI-ProteinID:  XP_008151876 LinkDB All DBs Position 20:38150018..38154029 Genome browser AA seq 91 aa AA seqDB search MKVHAAAFAVLLAAAAFCAPASASPYASDTTPCCFAYISRPLPRAHLQEYFYTSSKCSMP AVVLITRKNRQVCANPEKRWVREIINALEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaaggtccacgcagctgccttcgctgtgctcctcgccgcagccgccttctgcgctcct gcatcggcctccccatatgcctcggacaccacaccctgctgctttgcctacatctcccgc ccactgccccgtgcccacctccaggagtatttctataccagcagcaagtgctccatgcca gcagtcgtcttaatcacccgaaagaaccgtcaggtgtgtgccaacccagagaagagatgg gtgcgggagattatcaacgctttggagatgagctag

DBGET integrated database retrieval system