Eptesicus fuscus (big brown bat): 103298573 Help Entry 103298573         CDS       T09083                                  Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04020   Calcium signaling pathway efus04022   cGMP-PKG signaling pathway efus04024   cAMP signaling pathway efus04070   Phosphatidylinositol signaling system efus04114   Oocyte meiosis efus04218   Cellular senescence efus04261   Adrenergic signaling in cardiomyocytes efus04270   Vascular smooth muscle contraction efus04371   Apelin signaling pathway efus04625   C-type lectin receptor signaling pathway efus04713   Circadian entrainment efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04728   Dopaminergic synapse efus04740   Olfactory transduction efus04744   Phototransduction efus04750   Inflammatory mediator regulation of TRP channels efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04921   Oxytocin signaling pathway efus04922   Glucagon signaling pathway efus04924   Renin secretion efus04925   Aldosterone synthesis and secretion efus04970   Salivary secretion efus04971   Gastric acid secretion efus05010   Alzheimer disease efus05012   Parkinson disease efus05022   Pathways of neurodegeneration - multiple diseases efus05031   Amphetamine addiction efus05034   Alcoholism efus05133   Pertussis efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05214   Glioma efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103298573    04015 Rap1 signaling pathway     103298573    04371 Apelin signaling pathway     103298573    04020 Calcium signaling pathway     103298573    04070 Phosphatidylinositol signaling system     103298573    04024 cAMP signaling pathway     103298573    04022 cGMP-PKG signaling pathway     103298573  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     103298573    04218 Cellular senescence     103298573  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     103298573   09152 Endocrine system    04910 Insulin signaling pathway     103298573    04922 Glucagon signaling pathway     103298573    04912 GnRH signaling pathway     103298573    04915 Estrogen signaling pathway     103298573    04921 Oxytocin signaling pathway     103298573    04916 Melanogenesis     103298573    04924 Renin secretion     103298573    04925 Aldosterone synthesis and secretion     103298573   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103298573    04270 Vascular smooth muscle contraction     103298573   09154 Digestive system    04970 Salivary secretion     103298573    04971 Gastric acid secretion     103298573   09156 Nervous system    04728 Dopaminergic synapse     103298573    04720 Long-term potentiation     103298573    04722 Neurotrophin signaling pathway     103298573   09157 Sensory system    04744 Phototransduction     103298573    04740 Olfactory transduction     103298573    04750 Inflammatory mediator regulation of TRP channels     103298573   09159 Environmental adaptation    04713 Circadian entrainment     103298573  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103298573   09162 Cancer: specific types    05214 Glioma     103298573   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103298573    05163 Human cytomegalovirus infection     103298573    05167 Kaposi sarcoma-associated herpesvirus infection     103298573   09171 Infectious disease: bacterial    05133 Pertussis     103298573    05152 Tuberculosis     103298573   09164 Neurodegenerative disease    05010 Alzheimer disease     103298573    05012 Parkinson disease     103298573    05022 Pathways of neurodegeneration - multiple diseases     103298573   09165 Substance dependence    05031 Amphetamine addiction     103298573    05034 Alcoholism     103298573   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103298573    05418 Fluid shear stress and atherosclerosis     103298573  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:efus01009]     103298573   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103298573    03036 Chromosome and associated proteins [BR:efus03036]     103298573   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103298573 Protein phosphatases and associated proteins [BR:efus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103298573 Membrane trafficking [BR:efus04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103298573 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103298573 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103298573 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH Dockerin_1 EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 DUF5580_M EFhand_Ca_insen Caleosin FCaBP_EF-hand SurA_N_3 DUF1103 dCache_2 RFC1 Motif Other DBs NCBI-GeneID:  103298573 NCBI-ProteinID:  XP_027986699 LinkDB All DBs Position 2:28112421..28113765 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQLAEFREAFSLFDKDGDGTITTQELGTVMRALGQNPTQAELEGMVSEIDRDG NGTVDFPEFLGMMARRMKDRDSEEEIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDQ EVDEMIQAADVDGDGQVNYEEFVRMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacagaggagcagctggccgagttcagagaggccttctccctgttc gacaaggacggggacggcaccatcaccacccaggagctgggcaccgtcatgcgggccctg ggccagaaccccacgcaggccgagctcgagggcatggtgagcgagattgaccgcgatggc aacggcaccgtggacttccccgagttcctgggcatgatggccaggcgcatgaaggacagg gacagcgaggaggagatccgcgaggccttccgcgtgttcgacaaggacggcaacggcctg gtcagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgaccag gaggtggacgagatgatccaggcggcggacgtggatggggacgggcaggtcaactacgag gagttcgtccgcatgctggtctccaagtga

DBGET integrated database retrieval system