Eptesicus fuscus (big brown bat): 103298865 Help Entry 103298865         CDS       T09083                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04022   cGMP-PKG signaling pathway efus04024   cAMP signaling pathway efus04062   Chemokine signaling pathway efus04071   Sphingolipid signaling pathway efus04072   Phospholipase D signaling pathway efus04081   Hormone signaling efus04144   Endocytosis efus04150   mTOR signaling pathway efus04270   Vascular smooth muscle contraction efus04310   Wnt signaling pathway efus04350   TGF-beta signaling pathway efus04360   Axon guidance efus04510   Focal adhesion efus04520   Adherens junction efus04530   Tight junction efus04611   Platelet activation efus04621   NOD-like receptor signaling pathway efus04625   C-type lectin receptor signaling pathway efus04660   T cell receptor signaling pathway efus04670   Leukocyte transendothelial migration efus04722   Neurotrophin signaling pathway efus04810   Regulation of actin cytoskeleton efus04921   Oxytocin signaling pathway efus04928   Parathyroid hormone synthesis, secretion and action efus04972   Pancreatic secretion efus05100   Bacterial invasion of epithelial cells efus05132   Salmonella infection efus05133   Pertussis efus05135   Yersinia infection efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05205   Proteoglycans in cancer efus05206   MicroRNAs in cancer efus05210   Colorectal cancer efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     103298865 (RHOA)    04015 Rap1 signaling pathway     103298865 (RHOA)    04310 Wnt signaling pathway     103298865 (RHOA)    04350 TGF-beta signaling pathway     103298865 (RHOA)    04072 Phospholipase D signaling pathway     103298865 (RHOA)    04071 Sphingolipid signaling pathway     103298865 (RHOA)    04024 cAMP signaling pathway     103298865 (RHOA)    04022 cGMP-PKG signaling pathway     103298865 (RHOA)    04150 mTOR signaling pathway     103298865 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     103298865 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     103298865 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     103298865 (RHOA)    04520 Adherens junction     103298865 (RHOA)    04530 Tight junction     103298865 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     103298865 (RHOA)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103298865 (RHOA)    04621 NOD-like receptor signaling pathway     103298865 (RHOA)    04625 C-type lectin receptor signaling pathway     103298865 (RHOA)    04660 T cell receptor signaling pathway     103298865 (RHOA)    04670 Leukocyte transendothelial migration     103298865 (RHOA)    04062 Chemokine signaling pathway     103298865 (RHOA)   09152 Endocrine system    04921 Oxytocin signaling pathway     103298865 (RHOA)    04928 Parathyroid hormone synthesis, secretion and action     103298865 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     103298865 (RHOA)   09154 Digestive system    04972 Pancreatic secretion     103298865 (RHOA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103298865 (RHOA)   09158 Development and regeneration    04360 Axon guidance     103298865 (RHOA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103298865 (RHOA)    05206 MicroRNAs in cancer     103298865 (RHOA)    05205 Proteoglycans in cancer     103298865 (RHOA)    05203 Viral carcinogenesis     103298865 (RHOA)   09162 Cancer: specific types    05210 Colorectal cancer     103298865 (RHOA)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103298865 (RHOA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103298865 (RHOA)    05135 Yersinia infection     103298865 (RHOA)    05133 Pertussis     103298865 (RHOA)    05152 Tuberculosis     103298865 (RHOA)    05100 Bacterial invasion of epithelial cells     103298865 (RHOA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103298865 (RHOA)    05418 Fluid shear stress and atherosclerosis     103298865 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103298865 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     103298865 (RHOA)    04031 GTP-binding proteins [BR:efus04031]     103298865 (RHOA) Membrane trafficking [BR:efus04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     103298865 (RHOA) Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103298865 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    103298865 (RHOA)   Exosomal proteins of colorectal cancer cells    103298865 (RHOA)   Exosomal proteins of bladder cancer cells    103298865 (RHOA) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     103298865 (RHOA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  103298865 NCBI-ProteinID:  XP_008153875 LinkDB All DBs Position 18:complement(1540900..1573192) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaattggtgattgttggtgatggagcctgtggcaagacttgc ttgctcatcgtttttagcaaggaccagttcccagaggtgtatgtacctacggtgtttgag aactatgtggcagacattgaagtggacggaaagcaggtagagttggctttgtgggacaca gctgggcaggaggattatgatcgcttgaggcccctctcctacccggacacggatgtcatc ctgatgtgcttctccatcgacagccctgacagtttagaaaacatcccagaaaaatggact ccggaagtcaagcatttctgtcccaatgtgcccatcatcctggttgggaacaagaaggat cttcgaaacgatgagcacacaaggcgggagctggccaagatgaagcaggagccagtaaaa ccggaagaaggcagagatatggcaaacaggattggcgcatttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggttttcgaaatggccacgagagctgctctgcaa gccaggcgtgggaagaagaagtccgggtgccttgtgttgtga

DBGET integrated database retrieval system