Eptesicus fuscus (big brown bat): 103298949 Help Entry 103298949         CDS       T09083                                  Name (RefSeq) histone H4   KO K11254   histone H4 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04613   Neutrophil extracellular trap formation efus05034   Alcoholism efus05203   Viral carcinogenesis efus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     103298949  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     103298949   09163 Immune disease    05322 Systemic lupus erythematosus     103298949   09165 Substance dependence    05034 Alcoholism     103298949  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     103298949 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     103298949 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CENP-S CBFD_NFYB_HMF TFIID-31kDa Bromo_TP UPF0137 Motif Other DBs NCBI-GeneID:  103298949 NCBI-ProteinID:  XP_008154018 LinkDB All DBs Position 22:complement(14491309..14491749) Genome browser AA seq 103 aa AA seqDB search MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgtctgggagaggcaagggcggtaaaggcttaggcaaaggtggcgccaagcggcaccgc aaagtcctgcgagataacatccagggcatcaccaagcccgccatccggcgtctggctcgg cgtgggggcgtcaagcggatctcgggtcttatttacgaagaaactcggggtgtgctgaag gtgttcctggagaacgtcatccgggacgccgtcacctacacggagcacgccaagcgcaag acggtcacggccatggacgtggtgtacgccctgaagcggcagggccgcaccctgtacggc ttcggcggttag

DBGET integrated database retrieval system