Eptesicus fuscus (big brown bat): 103299860 Help Entry 103299860         CDS       T09083                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04015   Rap1 signaling pathway efus04810   Regulation of actin cytoskeleton efus05014   Amyotrophic lateral sclerosis efus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103299860 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103299860 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103299860 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103299860 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103299860 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:efus04812]     103299860 (PFN1)    04147 Exosome [BR:efus04147]     103299860 (PFN1) Membrane trafficking [BR:efus04131]  Others   Actin-binding proteins    Others     103299860 (PFN1) Cytoskeleton proteins [BR:efus04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103299860 (PFN1) Exosome [BR:efus04147]  Exosomal proteins   Proteins found in most exosomes    103299860 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103299860 NCBI-ProteinID:  XP_008154939 LinkDB All DBs Position 20:complement(12462420..12465344) Genome browser AA seq 140 aa AA seqDB search MASWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTVGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKSLVLLMGKEGVH GGIINKKCYEMASHLRRAQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcctcgtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaagttggtgtcctggttggcaaagaccggtcaagttttttc gtgaatgggctgacagtcgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggagtttaccatggatcttcgcaccaagagcaccgggggagcccccaccttcaac gtcactgtcaccatgactgccaagtcgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatcatcaacaagaaatgttatgaaatggcctcccacctgcggcgtgcccagtac tga

DBGET integrated database retrieval system