Eptesicus fuscus (big brown bat): 103301777 Help Entry 103301777         CDS       T09083                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04072   Phospholipase D signaling pathway efus04140   Autophagy - animal efus04150   mTOR signaling pathway efus04151   PI3K-Akt signaling pathway efus04152   AMPK signaling pathway efus04211   Longevity regulating pathway efus04218   Cellular senescence efus04714   Thermogenesis efus04910   Insulin signaling pathway efus04919   Thyroid hormone signaling pathway efus05163   Human cytomegalovirus infection efus05165   Human papillomavirus infection efus05168   Herpes simplex virus 1 infection efus05231   Choline metabolism in cancer Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04072 Phospholipase D signaling pathway     103301777 (RHEB)    04151 PI3K-Akt signaling pathway     103301777 (RHEB)    04152 AMPK signaling pathway     103301777 (RHEB)    04150 mTOR signaling pathway     103301777 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103301777 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     103301777 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     103301777 (RHEB)    04919 Thyroid hormone signaling pathway     103301777 (RHEB)   09149 Aging    04211 Longevity regulating pathway     103301777 (RHEB)   09159 Environmental adaptation    04714 Thermogenesis     103301777 (RHEB)  09160 Human Diseases   09161 Cancer: overview    05231 Choline metabolism in cancer     103301777 (RHEB)   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     103301777 (RHEB)    05163 Human cytomegalovirus infection     103301777 (RHEB)    05165 Human papillomavirus infection     103301777 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:efus04031]     103301777 (RHEB) GTP-binding proteins [BR:efus04031]  Small (monomeric) G-proteins   Ras Family    Rheb     103301777 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 DUF1842 Motif Other DBs NCBI-GeneID:  103301777 NCBI-ProteinID:  XP_054581916 LinkDB All DBs Position 14:complement(79136393..79178989) Genome browser AA seq 184 aa AA seqDB search MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFRRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc tcattgacaattcagtttgttgaaggccaatttgttgactcctacgacccaaccatagag aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcagctagtagac acagctgggcaagatgaatattccatctttccccagacatactccatagatattaatggt tatattctcgtgtattctgtgacatccatcaaaagttttgaggtgattaaagttatccat ggcaagttgttggacatggtggggaaagtgcaaatacctattatgttggttgggaataag aaagacctacatatggaaagggtgatcagttatgaagaagggaaggcgttagcagaatct tggaatgcagcttttttggaatcttctgctaaagagaatcaaactgctgttgatgtcttc agaaggataattttggaggcagaaaaaattgatggggccgcttcacaaggaaagtcttcc tgctcggtgatgtaa

DBGET integrated database retrieval system