Eptesicus fuscus (big brown bat): 103301979 Help Entry 103301979         CDS       T09083                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04024   cAMP signaling pathway efus04062   Chemokine signaling pathway efus04064   NF-kappa B signaling pathway efus04210   Apoptosis efus04380   Osteoclast differentiation efus04620   Toll-like receptor signaling pathway efus04621   NOD-like receptor signaling pathway efus04622   RIG-I-like receptor signaling pathway efus04623   Cytosolic DNA-sensing pathway efus04625   C-type lectin receptor signaling pathway efus04657   IL-17 signaling pathway efus04658   Th1 and Th2 cell differentiation efus04659   Th17 cell differentiation efus04660   T cell receptor signaling pathway efus04662   B cell receptor signaling pathway efus04668   TNF signaling pathway efus04722   Neurotrophin signaling pathway efus04920   Adipocytokine signaling pathway efus04926   Relaxin signaling pathway efus04931   Insulin resistance efus04936   Alcoholic liver disease efus05132   Salmonella infection efus05134   Legionellosis efus05135   Yersinia infection efus05140   Leishmaniasis efus05142   Chagas disease efus05145   Toxoplasmosis efus05160   Hepatitis C efus05161   Hepatitis B efus05162   Measles efus05163   Human cytomegalovirus infection efus05164   Influenza A efus05166   Human T-cell leukemia virus 1 infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05168   Herpes simplex virus 1 infection efus05169   Epstein-Barr virus infection efus05170   Human immunodeficiency virus 1 infection efus05171   Coronavirus disease - COVID-19 efus05200   Pathways in cancer efus05203   Viral carcinogenesis efus05208   Chemical carcinogenesis - reactive oxygen species efus05215   Prostate cancer efus05220   Chronic myeloid leukemia efus05222   Small cell lung cancer efus05235   PD-L1 expression and PD-1 checkpoint pathway in cancer efus05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103301979 (NFKBIA)    04668 TNF signaling pathway     103301979 (NFKBIA)    04024 cAMP signaling pathway     103301979 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     103301979 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103301979 (NFKBIA)    04621 NOD-like receptor signaling pathway     103301979 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     103301979 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     103301979 (NFKBIA)    04625 C-type lectin receptor signaling pathway     103301979 (NFKBIA)    04660 T cell receptor signaling pathway     103301979 (NFKBIA)    04658 Th1 and Th2 cell differentiation     103301979 (NFKBIA)    04659 Th17 cell differentiation     103301979 (NFKBIA)    04657 IL-17 signaling pathway     103301979 (NFKBIA)    04662 B cell receptor signaling pathway     103301979 (NFKBIA)    04062 Chemokine signaling pathway     103301979 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     103301979 (NFKBIA)    04926 Relaxin signaling pathway     103301979 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     103301979 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     103301979 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103301979 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     103301979 (NFKBIA)    05203 Viral carcinogenesis     103301979 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103301979 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     103301979 (NFKBIA)    05215 Prostate cancer     103301979 (NFKBIA)    05222 Small cell lung cancer     103301979 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     103301979 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     103301979 (NFKBIA)    05161 Hepatitis B     103301979 (NFKBIA)    05160 Hepatitis C     103301979 (NFKBIA)    05171 Coronavirus disease - COVID-19     103301979 (NFKBIA)    05164 Influenza A     103301979 (NFKBIA)    05162 Measles     103301979 (NFKBIA)    05168 Herpes simplex virus 1 infection     103301979 (NFKBIA)    05163 Human cytomegalovirus infection     103301979 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     103301979 (NFKBIA)    05169 Epstein-Barr virus infection     103301979 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     103301979 (NFKBIA)    05135 Yersinia infection     103301979 (NFKBIA)    05134 Legionellosis     103301979 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103301979 (NFKBIA)    05140 Leishmaniasis     103301979 (NFKBIA)    05142 Chagas disease     103301979 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103301979 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103301979 (NFKBIA)    04931 Insulin resistance     103301979 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:efus03000]     103301979 (NFKBIA)    04131 Membrane trafficking [BR:efus04131]     103301979 (NFKBIA) Transcription factors [BR:efus03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     103301979 (NFKBIA) Membrane trafficking [BR:efus04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     103301979 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  103301979 NCBI-ProteinID:  XP_008157202 LinkDB All DBs Position 5:complement(88660576..88663795) Genome browser AA seq 314 aa AA seqDB search MFHPAERAQDWAMEGPRDGLKKERPLDDRHDSGLDSMKDEEYEQMVKELREIRLEPQEAP RSPEPWKQQLTEDGDSFLHLAIIHEEKALTMEVVRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAQALLEAGCDPELRDFRGNTPLHLACEQGSLASVGVLTQSCGTQHLHAILQATN YNGHTCLHLASIHGYLGIVERLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL PYDDCVLGGQRLTL NT seq 945 nt NT seq  +upstreamnt  +downstreamnt atgtttcaccccgccgagcgcgcccaggactgggccatggagggcccccgggacgggctc aagaaggagcggccgctggatgaccgccacgacagcggcctggactccatgaaggacgag gagtacgagcagatggtgaaggagctgcgcgagatccgcctggagccgcaggaagcgccg cgcagccccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg gctatcatccatgaagagaaggcactgactatggaagtggtccgccaagtgaagggagac ctggccttcctgaacttccagaacaacctgcagcagactccgctccacttggctgtgatc accaaccagccagaaatcgctcaggcacttctggaagctggctgcgatcctgagctgcga gactttcgaggaaatacccccctgcaccttgcctgtgagcagggcagcctggccagtgtg ggagtcctgactcagagctgtgggacccagcacctccacgccatcctgcaggccaccaac tacaatggccacacgtgtctgcacttagcctccatccatggctacctgggcatcgtggag cgcctggtttccttgggtgctgatgtcaatgcccaggagccctgcaatggccggactgcc cttcatctcgcggtggacctgcagaatcccgacctggtgtctctcctgttgaagtgtggg gctgacgtcaacagagtcacctaccagggctactccccataccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgaccctagaaaacctccagatgctg ccagagagtgaggatgaggagagctatgacacagagtccgagttcacagaggacgagctg ccctatgatgactgtgtgcttggaggccagcgcctgacgttatga

DBGET integrated database retrieval system