Eptesicus fuscus (big brown bat): 103305459 Help Entry 103305459         CDS       T09083                                  Symbol PFN4 Name (RefSeq) profilin-4 isoform X1   KO K05759   profilin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04015   Rap1 signaling pathway efus04810   Regulation of actin cytoskeleton efus05014   Amyotrophic lateral sclerosis efus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103305459 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103305459 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     103305459 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103305459 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     103305459 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:efus04812]     103305459 (PFN4)    04147 Exosome [BR:efus04147]     103305459 (PFN4) Membrane trafficking [BR:efus04131]  Others   Actin-binding proteins    Others     103305459 (PFN4) Cytoskeleton proteins [BR:efus04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      103305459 (PFN4) Exosome [BR:efus04147]  Exosomal proteins   Proteins found in most exosomes    103305459 (PFN4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  103305459 NCBI-ProteinID:  XP_054584136 LinkDB All DBs Position 16:complement(18867664..18871535) Genome browser AA seq 141 aa AA seqDB search MSHLQNLLLDSLLGTKHVDSAALIQLQERSLCVASPGFSVMPSDVRTLVNGFAKNPLQAR REGLYFMEKDYRCVRADEYSLYAKNENTGVIVVKTNLYLLVATYTEGMYPSVCVEATEKL GKCVSHCLTLFPRGVGSSDCK NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgagccatctgcagaacttactcttagattccctcctgggcacgaagcatgtggacagc gcggccctcatccagctccaggagcggagcctgtgtgtcgcatcaccagggtttagtgtg atgcccagtgatgtgcgaacacttgtgaatgggttcgccaagaaccccctgcaagccaga agggaaggactgtatttcatggaaaaggactacagatgtgtccgggcagatgagtattct ctttatgctaagaatgaaaacactggtgtgattgtcgtgaagaccaatctgtatcttctg gtggcgacttacaccgagggcatgtatcccagtgtctgtgtggaagccacagagaagctg ggtaagtgtgtctcccactgcctgactttgttcccgaggggagtcgggtcttctgactgc aagtga

DBGET integrated database retrieval system