Eptesicus fuscus (big brown bat): 114233575 Help Entry 114233575         CDS       T09083                                  Name (RefSeq) histone H2B type 1-M-like   KO K11252   histone H2B Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04613   Neutrophil extracellular trap formation efus05034   Alcoholism efus05203   Viral carcinogenesis efus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     114233575  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     114233575   09163 Immune disease    05322 Systemic lupus erythematosus     114233575   09165 Substance dependence    05034 Alcoholism     114233575  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     114233575   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     114233575 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114233575 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114233575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa ARM_TT21 Motif Other DBs NCBI-GeneID:  114233575 NCBI-ProteinID:  XP_054567911 LinkDB All DBs Position 22:complement(727300..727759) Genome browser AA seq 126 aa AA seqDB search MPEPTKSAPAAKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagccaaccaagtcggcgcccgccgccaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system