Eptesicus fuscus (big brown bat): 129147023 Help Entry 129147023         CDS       T09083                                  Symbol URM1 Name (RefSeq) ubiquitin-related modifier 1   KO K12161   ubiquitin related modifier 1 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04122   Sulfur relay system Brite KEGG Orthology (KO) [BR:efus00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04122 Sulfur relay system     129147023 (URM1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:efus03016]     129147023 (URM1)    04121 Ubiquitin system [BR:efus04121]     129147023 (URM1) Transfer RNA biogenesis [BR:efus03016]  Eukaryotic type   tRNA modification factors    Thiolation factors     129147023 (URM1) Ubiquitin system [BR:efus04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    129147023 (URM1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Urm1 ThiS Motif Other DBs NCBI-GeneID:  129147023 NCBI-ProteinID:  XP_008150797 LinkDB All DBs Position 15:74077226..74093792 Genome browser AA seq 101 aa AA seqDB search MAAPLSVEVEFGGGAELLFDGVKKHQVTLPGQEEPWDIRNLLVWIKKNLLKERPELFIQG DSVRPGILVLINDADWELLGELDYQLQDQDSVLFISTLHGG NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcccttatcagtggaggtggagttcggaggtggcgcggagctcctgtttgac ggtgtaaaaaaacatcaggtcaccttgcctggacaggaggagccctgggacatccggaac ctccttgtctggatcaagaagaatttgctgaaagagcggccagagctgttcatccaggga gacagtgtgaggccgggaattctggtgctgattaacgatgcagactgggaactgctgggt gagctggactaccagcttcaggaccaggacagcgtcctcttcatatccactctgcacggt ggctaa

DBGET integrated database retrieval system