Eptesicus fuscus (big brown bat): 129147946 Help Entry 129147946         CDS       T09083                                  Name (RefSeq) histone H2B type 1-C/E/F/G/I   KO K11252   histone H2B Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04613   Neutrophil extracellular trap formation efus05034   Alcoholism efus05203   Viral carcinogenesis efus05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     129147946  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     129147946   09163 Immune disease    05322 Systemic lupus erythematosus     129147946   09165 Substance dependence    05034 Alcoholism     129147946  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:efus03036]     129147946   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     129147946 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Nucleosome assembly factors    Histones     129147946 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    129147946 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  129147946 NCBI-ProteinID:  XP_054567906 LinkDB All DBs Position 22:335435..335885 Genome browser AA seq 126 aa AA seqDB search MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcccgagcccgccaagtcggcgcccgccccgaagaagggctccaagaaggcggtgacc aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctcaagcaggtgcaccccgacaccggcatctcgtccaaggccatg ggcatcatgaactccttcgtcaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcattacaacaagcgctcgaccatcacgtcccgcgagatccagacggccgtgcgc ctgctgctgcccggcgagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system