Eptesicus fuscus (big brown bat): 129148572 Help Entry 129148572         CDS       T09083                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04014   Ras signaling pathway efus04015   Rap1 signaling pathway efus04020   Calcium signaling pathway efus04022   cGMP-PKG signaling pathway efus04024   cAMP signaling pathway efus04070   Phosphatidylinositol signaling system efus04114   Oocyte meiosis efus04218   Cellular senescence efus04261   Adrenergic signaling in cardiomyocytes efus04270   Vascular smooth muscle contraction efus04371   Apelin signaling pathway efus04625   C-type lectin receptor signaling pathway efus04713   Circadian entrainment efus04720   Long-term potentiation efus04722   Neurotrophin signaling pathway efus04728   Dopaminergic synapse efus04740   Olfactory transduction efus04744   Phototransduction efus04750   Inflammatory mediator regulation of TRP channels efus04910   Insulin signaling pathway efus04912   GnRH signaling pathway efus04915   Estrogen signaling pathway efus04916   Melanogenesis efus04921   Oxytocin signaling pathway efus04922   Glucagon signaling pathway efus04924   Renin secretion efus04925   Aldosterone synthesis and secretion efus04970   Salivary secretion efus04971   Gastric acid secretion efus05010   Alzheimer disease efus05012   Parkinson disease efus05022   Pathways of neurodegeneration - multiple diseases efus05031   Amphetamine addiction efus05034   Alcoholism efus05133   Pertussis efus05152   Tuberculosis efus05163   Human cytomegalovirus infection efus05167   Kaposi sarcoma-associated herpesvirus infection efus05170   Human immunodeficiency virus 1 infection efus05200   Pathways in cancer efus05214   Glioma efus05417   Lipid and atherosclerosis efus05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     129148572    04015 Rap1 signaling pathway     129148572    04371 Apelin signaling pathway     129148572    04020 Calcium signaling pathway     129148572    04070 Phosphatidylinositol signaling system     129148572    04024 cAMP signaling pathway     129148572    04022 cGMP-PKG signaling pathway     129148572  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     129148572    04218 Cellular senescence     129148572  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129148572   09152 Endocrine system    04910 Insulin signaling pathway     129148572    04922 Glucagon signaling pathway     129148572    04912 GnRH signaling pathway     129148572    04915 Estrogen signaling pathway     129148572    04921 Oxytocin signaling pathway     129148572    04916 Melanogenesis     129148572    04924 Renin secretion     129148572    04925 Aldosterone synthesis and secretion     129148572   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     129148572    04270 Vascular smooth muscle contraction     129148572   09154 Digestive system    04970 Salivary secretion     129148572    04971 Gastric acid secretion     129148572   09156 Nervous system    04728 Dopaminergic synapse     129148572    04720 Long-term potentiation     129148572    04722 Neurotrophin signaling pathway     129148572   09157 Sensory system    04744 Phototransduction     129148572    04740 Olfactory transduction     129148572    04750 Inflammatory mediator regulation of TRP channels     129148572   09159 Environmental adaptation    04713 Circadian entrainment     129148572  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     129148572   09162 Cancer: specific types    05214 Glioma     129148572   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     129148572    05163 Human cytomegalovirus infection     129148572    05167 Kaposi sarcoma-associated herpesvirus infection     129148572   09171 Infectious disease: bacterial    05133 Pertussis     129148572    05152 Tuberculosis     129148572   09164 Neurodegenerative disease    05010 Alzheimer disease     129148572    05012 Parkinson disease     129148572    05022 Pathways of neurodegeneration - multiple diseases     129148572   09165 Substance dependence    05031 Amphetamine addiction     129148572    05034 Alcoholism     129148572   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129148572    05418 Fluid shear stress and atherosclerosis     129148572  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:efus01009]     129148572   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:efus04131]     129148572    03036 Chromosome and associated proteins [BR:efus03036]     129148572   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     129148572 Protein phosphatases and associated proteins [BR:efus01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      129148572 Membrane trafficking [BR:efus04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     129148572 Chromosome and associated proteins [BR:efus03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      129148572 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    129148572 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EF_EFCAB10_C EH EF-hand_11 SAPC2_N SPARC_Ca_bdg UPF0154 EF-hand_STIM1 EFhand_Ca_insen EF-hand_EFHB_C Dockerin_1 Caleosin FCaBP_EF-hand TerB SPEF2_C DUF5580_M DUF1103 PA_Ig-like ExbD MecA_N Motif Other DBs NCBI-GeneID:  129148572 NCBI-ProteinID:  XP_054569824 LinkDB All DBs Position 3:52678493..52679062 Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFHVFDKDGNGYISVAELRHVMTNLGEKLTDE EVDEMTREVDIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggctgaccaactgactgaagagcagattgcagaattcaaagaagctttttcactattt gacaaggatggtgatggaaccataacaacaaaggaattgggaactgtaatgaggtctctt gggcagaatcccacagaagcagagttacaggacatgataaatgaagtggatgctgatggt aatggcacaatcgacttcccagaatttctgacaatgatggcaagaaaaatgaaagacaca gacagtgaagaagaaattcgagaagcattccatgtgtttgataaggatggcaatggctat attagtgtagcagagcttcgccatgtgatgacaaaccttggagagaagttaacagatgaa gaggttgatgaaatgaccagggaagtagatattgatggtgatggtcaagtaaactatgaa gagtttgtacaaatgatgacagcaaagtga

DBGET integrated database retrieval system