Eptesicus fuscus (big brown bat): 129149038 Help Entry 129149038         CDS       T09083                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism efus  Eptesicus fuscus (big brown bat) Brite KEGG Orthology (KO) [BR:efus00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:efus03041]     129149038   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:efus04052]     129149038 Spliceosome [BR:efus03041]  Complex B   Other components    Complex B specific factors     129149038 Cytokines and neuropeptides [BR:efus04052]  Neuropeptides   Unclassified    129149038 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  129149038 NCBI-ProteinID:  XP_054571605 LinkDB All DBs Position 5:complement(107815528..107815927) Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggttgtttgcaacgaccgtctggggaagaaggtccgcgtcaagtgcaacacc gatgacaccatcggggacctcaagaagctgatcgcagcccaaacggggacccgttggaac aagatcgtgttgaagaagtggtacacgatttttaaggaccacgtttctctgggggactat gaaatccatgatgggatgaacctggagctgtattaccaatag

DBGET integrated database retrieval system