Eptesicus fuscus (big brown bat): 129150131 Help Entry 129150131         CDS       T09083                                  Name (RefSeq) beta-defensin 1-like   KO K23125   beta-defensin 1 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus02010   ABC transporters efus05150   Staphylococcus aureus infection Brite KEGG Orthology (KO) [BR:efus00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     129150131  09160 Human Diseases   09171 Infectious disease: bacterial    05150 Staphylococcus aureus infection     129150131  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:efus02000]     129150131    03037 Cilium and associated proteins [BR:efus03037]     129150131 Transporters [BR:efus02000]  Other transporters   Pores ion channels [TC:1]    129150131 Cilium and associated proteins [BR:efus03037]  Motile cilia and associated proteins   Sperm associated proteins    129150131 SSDB OrthologParalogGFIT Motif Pfam:  Defensin_beta Motif Other DBs NCBI-GeneID:  129150131 NCBI-ProteinID:  XP_054576317 LinkDB All DBs Position 8:complement(104605067..104606076) Genome browser AA seq 74 aa AA seqDB search MRLFHILLLPLCLLFAQVGPGAGLLLVEVPKSPEHMCIKKRGHCYFNPCPTFLTHDGYCY RGKAKCCYWEDRGR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaggctcttccacatcctgctgctgcctctctgcctgctcttcgcccaggtgggccca ggtgctggcctcctcttggtcgaggtccccaagagcccagaacacatgtgcatcaaaaag agggggcactgctacttcaacccgtgcccaaccttcctgacacacgatggctactgctac agagggaaggccaagtgctgctactgggaggaccgggggagataa

DBGET integrated database retrieval system