Eptesicus fuscus (big brown bat): 129151100 Help Entry 129151100         CDS       T09083                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism efus  Eptesicus fuscus (big brown bat) Pathway efus04382   Cornified envelope formation efus05132   Salmonella infection Brite KEGG Orthology (KO) [BR:efus00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     129151100  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129151100  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:efus04147]     129151100 Exosome [BR:efus04147]  Exosomal proteins   Exosomal proteins of microglial cells    129151100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_6 EF-hand_8 Motif Other DBs NCBI-GeneID:  129151100 NCBI-ProteinID:  XP_054580882 LinkDB All DBs Position 13:complement(28666830..28667471) Genome browser AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGRVGFQSFFSLIAGLTIACNDYFVVHMKQKGRK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggaacacgccatggaaaccatgatgttcacgtttcacaagtttgct ggggataaaggctacttaacaaaggaggacctaagagtactcatggaaaaggagttccct gggtttttggaaaatcaaaaagaccctctggctgtagacaaaataatgaaggacctggac cagtgccgagacggcagagtgggcttccagagcttcttttcgctaattgctgggctcacc atcgcatgcaatgactatttcgtagtacacatgaagcagaagggaaggaagtga

DBGET integrated database retrieval system