Qipengyuania flava: CHH26_10480 Help Entry CHH26_10480       CDS       T04986                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism efv  Qipengyuania flava Pathway efv01100   Metabolic pathways efv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:efv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CHH26_10480    00074 Mycolic acid biosynthesis     CHH26_10480   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CHH26_10480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ASP30608 LinkDB All DBs Position complement(2125980..2126216) Genome browser AA seq 78 aa AA seqDB search MSDTADRVQKIVVEHLGVEADKVTQEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKITTVGDATKYIEEHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatactgccgaccgcgtgcagaagattgtcgtcgagcatctcggcgtcgaggcc gacaaggtcacccaggaagccagcttcatcgacgatctcggtgcagacagcctcgacatc gttgagctggtgatggcttttgaagaagagttcggcgttgaaatccccgacgatgcggct gagaagatcaccaccgtcggcgacgcgaccaagtacatcgaagagcacaagggctaa

DBGET integrated database retrieval system