Eggerthella guodeyinii: GS424_009730 Help Entry GS424_009730      CDS       T07376                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism egd  Eggerthella guodeyinii Pathway egd00020   Citrate cycle (TCA cycle) egd00720   Other carbon fixation pathways egd01100   Metabolic pathways egd01110   Biosynthesis of secondary metabolites egd01120   Microbial metabolism in diverse environments egd01200   Carbon metabolism egd01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:egd00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GS424_009730   09102 Energy metabolism    00720 Other carbon fixation pathways     GS424_009730 Enzymes [BR:egd01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GS424_009730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_15 Fer4_21 Fer4_16 Fer4_4 Fer4_3 Fer4_22 Fer4_13 Fer4_8 Fer4_17 Fer4_18 Motif Other DBs NCBI-ProteinID:  QOS66835 UniProt:  A0A6L7ITH8 LinkDB All DBs Position complement(2309476..2309682) Genome browser AA seq 68 aa AA seqDB search MARISVDDSFCKGCGLCVDACPERIMALDHDKITAKGYHPAYCTDMDACTGCMSCATMCP DVAITVER NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggcgagaatcagcgtagacgactccttctgcaaggggtgcggcctgtgcgtcgacgcg tgccccgagcggatcatggcgctcgaccacgacaagatcaccgcgaagggctaccacccc gcgtactgcaccgacatggatgcgtgcacgggctgcatgtcttgcgcgacgatgtgccct gacgttgcgatcacggtagagaggtag

DBGET integrated database retrieval system