Duffyella gerundensis: EM595_0087 Help Entry EM595_0087        CDS       T04258                                  Name (GenBank) hypothetical protein   KO K03676   glutaredoxin 3 Organism ege  Duffyella gerundensis Brite KEGG Orthology (KO) [BR:ege00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ege03110]     EM595_0087 Chaperones and folding catalysts [BR:ege03110]  Protein folding catalysts   Protein disulfide isomerase    EM595_0087 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR GST_N Thioredoxin_2 Lar_restr_allev Thioredoxin_3 CLIC-like_N Motif Other DBs NCBI-ProteinID:  CUU22324 UniProt:  A0A0U5GGC2 LinkDB All DBs Position 1:91773..92024 Genome browser AA seq 83 aa AA seqDB search MANIEIYTKATCPFCHRAKALLEQKGAAFQEIPIDGDADKREEMIKRSGRTTVPQIFIDA QHIGGCDDLYALDGRNGLDSLLQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggccaatattgagatctataccaaagcgacctgccctttttgccatcgggcaaaagcg ctgttggaacagaaaggcgcagcatttcaggaaatccccattgatggtgatgccgataag cgcgaagagatgatcaaacgtagcggccgtacaaccgttcctcaaatttttatcgatgcg cagcacattggtggctgtgacgatttatatgcgctcgacggacgaaacggacttgattcc cttttgcagtaa

DBGET integrated database retrieval system